KEGG   Erwinia tasmaniensis: ETA_15990Help
Entry
ETA_15990         CDS       T00711                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eta  Erwinia tasmaniensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ETA_15990 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETA_15990 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETA_15990 (trpA)
Enzymes [BR:eta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ETA_15990 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1811686..1812492)
Genome map
AA seq 268 aa AA seqDB search
MERYDLCFKRLAEKQEGAFVPFVTLGDPTPELSLQIIDALVAGGADALELGIPFSDPLAD
GPTIQNANLRAFAAGVTPEHCFDMLAAIRQKYPDMPIGLLMYANLVFSNGIDSFYARCQQ
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNAGDDLLREISSHGRGYTYLLSRA
GVTGSETRASLPLKHLVDKLREYHAAPALQGFGISEASQVQQAISAGAAGAISGSAVVRI
IEKHLNDPALMLSELTAFAASLKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttacgatctctgtttcaaacgcctggccgaaaaacaggagggcgcgtttgtt
cccttcgtcaccctcggcgacccaacgccggagctgtcgttgcagattatcgacgcgctg
gtggcgggcggtgccgatgcccttgagctgggtatccctttctccgatccgctggcggat
ggccccaccatccagaatgcaaacctgcgcgccttcgcggccggcgtcacgccagagcac
tgttttgacatgctggcggctatccgccagaaatacccggacatgccgattggcctgctg
atgtacgctaacctggtgttttccaacggcattgatagcttctatgcccgttgccagcag
gttggcgtggattcggtgctggtggccgatgtgccggttgaagagtctgcgcctttccgc
caggcagcgatgcgacacaacgttgcgccaattttcatctgcccgccaaacgccggtgac
gatttgctgcgtgaaatttcctctcacggtcggggttatacctatctgctgtcccgtgcc
ggggtgaccggttcagaaacccgcgccagcctgccgcttaaacatctggtggataaactg
cgcgaatatcacgctgccccggcactgcagggctttggtatttctgaagcttcacaggtg
cagcaggcgatttccgccggggcggcaggcgctatttcaggctcagcggtggtcaggatc
atcgagaagcacctgaacgaccctgcgctgatgctgtcggagctgaccgcctttgccgcc
agcctgaaggcagcgacccggagctaa

DBGET integrated database retrieval system