KEGG   Erwinia tasmaniensis: ETA_16000Help
Entry
ETA_16000         CDS       T00711                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00260  Glycine, serine and threonine metabolism
eta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01130  Biosynthesis of antibiotics
eta01230  Biosynthesis of amino acids
Module
eta_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETA_16000 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETA_16000 (trpB)
Enzymes [BR:eta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ETA_16000 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAO96646
UniProt: B2VKT2
Position
complement(1812492..1813682)
Genome map
AA seq 396 aa AA seqDB search
MTRLNPYFGEFGGMYVPQILMPALLQLEDAFISAQSDPAFQAEFTDLLKNYAGRPTALTR
CLNLTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNLFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSY
ETAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILQQEGRLPDAVIACVGGGSNAIGMF
ADFIDEPGVELIGVEPGGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTADGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRANYVSITDEEALDAFKALCRSEGIIPALESSHALAHALKM
MREAPEKEQLLVVNLSGRGDKDIFTVHDILTAKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtttaaatccttattttggtgagtttggcggtatgtatgtgccgcagatcctg
atgcctgccctgctgcagctggaagatgcctttatcagcgcgcagagcgacccggcattc
caagccgaatttaccgacctgctgaaaaattatgccggacgtcctaccgcgctgacgcga
tgtctgaacctgaccaaaggcagcaaaacgcgcctttatctcaagcgtgaagacctactg
cacggcggcgcgcacaagactaaccaggtccttggccaggcgttgctggcaaaacgcatg
ggcaaaaaagaaattattgccgaaacgggagccggtcagcacggcgttgcctcggcgctg
gcctgcgcgctgcttggcctgaaatgccgtatttatatgggcgcgaaggacattgaacgc
cagtcgcctaatttgttccgtatgcgtctgatgggcgcagaagtgatcccggtgcacagc
ggttccgccaccctgaaagatgcctgcaatgaagcgctgcgcgactggtccggcagctat
gaaaccgctcactatatgctgggcaccgcagcaggcccgcatccgttcccgaccatcgtg
cgcgaattccagcgcatgattggtgaagagaccaaagcccagatcctgcaacaggaaggt
cgcctgcccgatgccgtgatagcctgcgtcggcgggggttcgaacgccatcggcatgttt
gccgactttatcgatgagccgggcgtcgagctgattggcgtggagccaggcggtcacggt
attgaaagcggcgaacatggcgctccgctcaagcacggacgcgtgggtatttatttcggt
atgaagtcgccgatgatgcaaaccgcagacgggcagatcgaagaatcttattctatttca
gccggtctcgacttcccttccgtcgggccgcagcatgcgcatcttaacagtatcggccgg
gcgaactacgtgtcgatcaccgatgaagaagcgctggacgccttcaaagcgctgtgccgt
agcgaagggatcatcccggcgctggagtcttcgcacgcgctggcccatgcgctgaagatg
atgcgcgaggccccggaaaaagagcagctgctggtggttaatctttccggacggggtgac
aaagatattttcaccgtgcacgacatccttaccgctaagggagaaatctga

DBGET integrated database retrieval system