KEGG   Erwinia tasmaniensis: ETA_16980Help
Entry
ETA_16980         CDS       T00711                                 

Gene name
glsA
Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00220  Arginine biosynthesis
eta00250  Alanine, aspartate and glutamate metabolism
eta00471  D-Glutamine and D-glutamate metabolism
eta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETA_16980 (glsA)
   00220 Arginine biosynthesis
    ETA_16980 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ETA_16980 (glsA)
Enzymes [BR:eta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ETA_16980 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CAO96744
UniProt: B2VKI3
Position
1927900..1928823
Genome map
AA seq 307 aa AA seqDB search
MSALDNTLLEDILRQARPLIGQGKVANYIPALADVPAERLGIAVCTLDGTVYQAGDAEER
FSIQSISKVLSLTLAMTRYHESELWQRVGKEPSGQPFNSLLQLELEQGKPRNPFINAGAL
VVCDMLETRLTAPRQRMLEVVRSLTQQPEINYDRHVARSEFDHSARNAAIAWLMKSFGNF
ANDVPKVLQTYFHYCSMTMSCVELARCFLYLANHGRSLGQEAAVLTPKQTRQINALMVTS
GMYDGAGEFAWRVGMPGKSGVGGGIIAVVPGEMSIAVWSPELDGSGNSLAGTAALELLAE
RIGRSIF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctctggataatacattgttggaagatattctccggcaggcacggccattaatc
gggcagggcaaggtcgcaaactatattccagccctggctgatgttcctgctgagcgactg
ggaatagccgtctgcaccctggatggcaccgtttatcaggcgggagatgcagaagaacgt
ttttccatacagtctatttcaaaagtactctcactgacgctggccatgacgcgttaccac
gaaagcgaactgtggcagcgggtaggaaaagagccgtctggccaaccgtttaactccctg
ttacagcttgaactggagcaggggaaaccgcgcaatccgtttattaacgcaggggcgctg
gtggtgtgcgatatgttggaaacgcgtcttaccgcaccgcgtcagcgtatgctggaagtg
gttcgtagcctgacgcagcagccggaaatcaattacgaccgtcacgtggcgcgttctgaa
tttgaccactccgcgcgtaatgcggccattgcctggctgatgaaatcatttggtaacttt
gccaacgatgtaccaaaagtattgcaaacctattttcactactgctcgatgacgatgagc
tgtgttgaactggcgcgctgctttctttatctcgctaatcatgggcgcagccttggccag
gaagcggcggtgctaaccccgaagcagacccgacagattaacgccttaatggtgaccagc
gggatgtatgatggtgccggtgagtttgcatggcgggtagggatgccgggaaaatcgggc
gttggcggcggtattattgccgtagtgcctggagagatgagtatcgccgtgtggtctcca
gagctggatggttccggcaattcgctggccggcacggcggcgttggaactgctggctgag
cgtatcgggcgctcaattttttga

DBGET integrated database retrieval system