KEGG   Erwinia tasmaniensis: ETA_16980Help
Entry
ETA_16980         CDS       T00711                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
eta  Erwinia tasmaniensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETA_16980 (glsA)
   00330 Arginine and proline metabolism
    ETA_16980 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ETA_16980 (glsA)
Enzymes [BR:eta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ETA_16980 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1927900..1928823
Genome map
AA seq 307 aa AA seqDB search
MSALDNTLLEDILRQARPLIGQGKVANYIPALADVPAERLGIAVCTLDGTVYQAGDAEER
FSIQSISKVLSLTLAMTRYHESELWQRVGKEPSGQPFNSLLQLELEQGKPRNPFINAGAL
VVCDMLETRLTAPRQRMLEVVRSLTQQPEINYDRHVARSEFDHSARNAAIAWLMKSFGNF
ANDVPKVLQTYFHYCSMTMSCVELARCFLYLANHGRSLGQEAAVLTPKQTRQINALMVTS
GMYDGAGEFAWRVGMPGKSGVGGGIIAVVPGEMSIAVWSPELDGSGNSLAGTAALELLAE
RIGRSIF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctctggataatacattgttggaagatattctccggcaggcacggccattaatc
gggcagggcaaggtcgcaaactatattccagccctggctgatgttcctgctgagcgactg
ggaatagccgtctgcaccctggatggcaccgtttatcaggcgggagatgcagaagaacgt
ttttccatacagtctatttcaaaagtactctcactgacgctggccatgacgcgttaccac
gaaagcgaactgtggcagcgggtaggaaaagagccgtctggccaaccgtttaactccctg
ttacagcttgaactggagcaggggaaaccgcgcaatccgtttattaacgcaggggcgctg
gtggtgtgcgatatgttggaaacgcgtcttaccgcaccgcgtcagcgtatgctggaagtg
gttcgtagcctgacgcagcagccggaaatcaattacgaccgtcacgtggcgcgttctgaa
tttgaccactccgcgcgtaatgcggccattgcctggctgatgaaatcatttggtaacttt
gccaacgatgtaccaaaagtattgcaaacctattttcactactgctcgatgacgatgagc
tgtgttgaactggcgcgctgctttctttatctcgctaatcatgggcgcagccttggccag
gaagcggcggtgctaaccccgaagcagacccgacagattaacgccttaatggtgaccagc
gggatgtatgatggtgccggtgagtttgcatggcgggtagggatgccgggaaaatcgggc
gttggcggcggtattattgccgtagtgcctggagagatgagtatcgccgtgtggtctcca
gagctggatggttccggcaattcgctggccggcacggcggcgttggaactgctggctgag
cgtatcgggcgctcaattttttga

DBGET integrated database retrieval system