KEGG   Erwinia tasmaniensis: ETA_18820Help
Entry
ETA_18820         CDS       T00711                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eta  Erwinia tasmaniensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:eta00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2134520..2135377
Genome map
AA seq 285 aa AA seqDB search
MITTWPAPAKLNLFLYITGRRPDGYHDLQTLFQFLDYGDTLTIETNQSGTLRLLSPLDGV
PDDDNLIIRAAKLLREQAQKHSTLPANAGANLAVTKRLPMGGGLGGGSSNAATVLVALNH
LWQTGFSLHQLAAFGLQLGADVPVFVQGFAAFAEGVGERLMPVSPPEKWYLVMHPGVSIA
TPLVFNDPLLTRNTPRREISALLSAEFRNDCEAVVRNRFREVEQLVSWLLEYAPSRLTGT
GACVFAEFDTESAARQVFELAPAGLQGFIAQGVNISPLHRTLSEQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccacatggcccgcaccggcaaagctgaacctttttctctacatcactggccgt
cgcccggatggctatcacgatctgcagacgctgtttcagttcctcgattatggcgatacc
ctgacgattgaaaccaatcaaagtgggactttacggctgttgagcccgctggacggggtg
ccggacgatgacaacctgattattcgtgcggcaaaactgctgcgcgaacaggcgcaaaag
cacagcaccctgccagccaacgcgggcgcaaatctggcggtaacgaaacggctgccgatg
ggcggcgggctgggcggcggttcttctaacgccgccacggtgctggtggcgcttaatcac
ctttggcaaaccggcttcagtttacaccagctggcagcctttggcctgcagctgggtgcc
gacgtgccggtgtttgtgcagggcttcgccgcctttgccgaaggcgttggcgagcggctt
atgccggtctcccccccggagaagtggtatcttgtgatgcaccctggggtcagtatcgcc
actcctttggtgttcaatgatcctttattgaccagaaacacgccacgtcgtgaaatcagc
gccctgttatccgctgaattccgcaatgattgtgaggcagtcgtaagaaatcgttttcgt
gaggttgaacagcttgtttcctggctgctagaatacgcgccgtcacgcctgaccgggacg
ggtgcttgtgtgtttgcagaatttgacaccgagtccgcggcccgtcaggtgtttgagctg
gctccggctggattgcagggatttattgcgcaaggcgttaacatttctccgctacatcgc
accctgtcggagcaatag

DBGET integrated database retrieval system