KEGG   Erwinia tasmaniensis: ETA_21440Help
Entry
ETA_21440         CDS       T00711                                 

Gene name
aroA
Definition
(GenBank) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01130  Biosynthesis of antibiotics
eta01230  Biosynthesis of amino acids
Module
eta_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETA_21440 (aroA)
Enzymes [BR:eta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     ETA_21440 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: CAO97190
UniProt: B2VC79
Position
complement(2415667..2416953)
Genome map
AA seq 428 aa AA seqDB search
MQDSLTLQPIALVDGTVNLPGSKSVSNRALLLAALAEGTTRLTNLLDSDDVRHMLDALKA
IGVKYSLSADRTCCEIVGQGGPLNAKEPLELFLGNAGTAMRPLAAALCIGNGDVVLTGEP
RMKERPIGHLVDALRQGGAEVEYLEQENYPPLRVKGGFSGGEVTVNGSVSSQFLTALLMA
APLAPNDTRIVIKGDLVSKPYIDITLKLMATFGVVVENNDYDTFHISGQQQYQATREYLV
EGDASSASYFLAAAAIKGGTVKVTGIGRNSMQGDIHFADVLEKMGASVEWGDDYIACTRG
DLNAVDLDMNHIPDAAMTIATTALFAQGTTVMRNIYNWRVKETDRLTAMATELRKVGAEV
EEGHDFISITPPAKIVFAEIGTYNDHRMAMCFSLVALSSSPVTILDPKCTAKTFPDYFEQ
LARLSHLA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattccctgacgttacaaccaatcgccctggtcgacggcaccgttaaccttcct
ggctccaagagcgtatctaaccgtgccttattgctggcagcgctggcagagggaacgacc
cgtctgaccaacctgctcgatagtgatgacgtgcgtcatatgctggatgcgctgaaggcg
atcggcgtaaaatattcactgtctgccgaccgcacatgctgcgagatagttggtcagggt
gggccactgaatgcgaaagaaccgcttgagcttttcctcggcaatgcgggcaccgcgatg
cgcccgcttgcggcagcattgtgtattggtaacggcgatgttgttcttaccggtgagccg
cgaatgaaagagcgcccgataggacatttggtggatgccctacgccaggggggggccgaa
gtcgagtatcttgagcaggagaattacccaccactgcgtgttaagggcgggttcagcggt
ggtgaagtcacggtaaatggtagcgtatccagccagtttttgaccgcgttgttgatggcc
gcaccgctggcgccaaatgatacccggatcgtgatcaaaggcgatctggtttctaaacct
tatattgatatcactctcaagctgatggcgactttcggcgtagtggtggaaaataacgac
tatgatactttccatatcagcgggcagcagcagtatcaggcaacgcgcgaatatttggta
gaaggcgatgcatcttctgcttcttactttctggccgctgcggcaatcaaaggcggtacg
gtcaaagtgaccggtattggccgtaacagtatgcagggcgatattcactttgccgatgta
ctggaaaaaatgggtgccagcgtggagtggggcgatgattacattgcctgcacgcgtggt
gacctcaacgccgtcgatttggatatgaaccatattcccgacgctgctatgaccattgcc
accaccgcattatttgcacaaggcaccacggtaatgcgcaatatttataactggcgtgtg
aaagagaccgaccgtctgacagcgatggctaccgagttacgcaaagtgggagctgaagtt
gaagaggggcatgatttcattagtattactcctccagcgaaaatcgtattcgcggaaatc
ggtacttacaacgatcatcgcatggcaatgtgcttctcgctggtggcgctctcttccagt
ccggtgactatccttgacccgaagtgtactgccaaaacgttccctgattatttcgaacag
ctggcccgtcttagccatttggcataa

DBGET integrated database retrieval system