KEGG   Erwinia tasmaniensis: ETA_23070Help
Entry
ETA_23070         CDS       T00711                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eta  Erwinia tasmaniensis
Pathway
eta00020  Citrate cycle (TCA cycle)
eta00190  Oxidative phosphorylation
eta00650  Butanoate metabolism
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01120  Microbial metabolism in diverse environments
eta01130  Biosynthesis of antibiotics
eta01200  Carbon metabolism
Module
eta_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eta_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eta_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETA_23070 (sdhD)
   00650 Butanoate metabolism
    ETA_23070 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ETA_23070 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAO97353
UniProt: B2VBS1
Position
complement(2609728..2610075)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIHDWLLLRAAAMIMTFYVLYILAFIVMSGPLTFDIWRGFFASSFTKVF
TLLTLFSILVHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgcactggggcgcaacggcattcacgactggctgctgttgcgt
gccgccgcgatgataatgaccttttacgtcctttatatcctcgcttttattgtgatgtcc
gggccactgacttttgatatctggcgtggttttttcgcttcctccttcacgaaagttttc
acccttctgacgctgttctccattctggtgcacggttggattgggatgtggcaggtactg
actgactatattaaaccccttgcgctgcgcatgatgttgcagctggttgtcgtggtcgca
ctgttggtgtatgccatttatggaactgttgttgtgtggggtgcgtga

DBGET integrated database retrieval system