KEGG   Erwinia tasmaniensis: ETA_24370Help
Entry
ETA_24370         CDS       T00711                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eta  Erwinia tasmaniensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ETA_24370 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETA_24370 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    ETA_24370 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ETA_24370 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ETA_24370 (adhP)
   00626 Naphthalene degradation
    ETA_24370 (adhP)
Enzymes [BR:eta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ETA_24370 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2743110..2744126
Genome map
AA seq 338 aa AA seqDB search
MKAAVVTHDHQVDVVEKTLRALQHGEALLTMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVKSVGPGVTSLKPGDRASVAWFFKGCGHCEYCNSGNETLCREVVNAGYTADGGMAEE
CIVAADYAVKVPDGLDSAVASSITCAGVTTYKAVKISGITPGKWLVVYGLGGLGNLALQY
AKNVFNARVIAVDVSDAQLKFAEEMGADMVINSRNEDAAKLIQQRTGGAHAAVVTAVAKA
AFNSAVDAMRAGGRIVAVGLPSESMSLNIPRLVLDGIQVVGSLVGTREDLAEAFQFAAEG
KVVPKVTRRPLQDINAIFHEMESGKIVGRMVIDFNRTH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgtcactcacgatcatcaggttgatgtggtagagaaaaccctccgc
gcgttgcaacatggcgaagccctgctcactatggagtgttgcggggtctgtcacaccgac
ctgcacgtcaaaaacggggattttggcgataagaccggcgttatcctcggtcacgaaggg
attggcgttgtcaaatctgtgggtccaggcgtcacctcccttaagccaggcgaccgtgcc
agcgtggcgtggtttttcaaaggctgcggccattgtgaatactgcaacagcggcaatgaa
acgctgtgccgcgaggttgtcaacgccggttatacggccgatggcggcatggccgaagag
tgtatcgtggcggcggattatgccgtgaaggtgcctgacggtctcgattccgcggtggcc
agcagcatcacctgcgccggggtcaccacctataaggcggtcaaaatctccggcatcacc
cccgggaaatggctggttgtttatggccttggtggcttaggtaatcttgcgctgcaatac
gcaaaaaacgtgtttaatgccagggttatcgccgttgacgtcagcgatgcccagctgaaa
tttgccgaagagatgggggccgatatggtgatcaactcacgcaatgaagacgcggcaaag
ctcattcagcaacgcacggggggcgcacatgcggcggtagtcacggcggttgccaaagcg
gcgtttaactctgcggtggatgcgatgcgcgccggcggccgtattgtggcagtcggactg
ccgtctgaatcaatgagcctgaatatcccgcgcctggtgctggacggcatccaggtcgtg
ggctcgctggtcggcacgcgtgaagatttagctgaagccttccagttcgcggctgaaggc
aaggtggtacccaaagttacccgccgtccgctacaggatatcaacgcgatcttccatgaa
atggagagcggcaaaatcgttggccgtatggtgattgactttaaccgtactcattaa

DBGET integrated database retrieval system