KEGG   Erwinia tasmaniensis: ETA_24430Help
Entry
ETA_24430         CDS       T00711                                 

Gene name
purK
Definition
phosphoribosylaminoimidazole carboxylase ATPase subunit
Orthology
K01589  
5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
eta  Erwinia tasmaniensis
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eta00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2747687..2748754
Genome map
AA seq 355 aa AA seqDB search
MKPVCVLGNGQLGRMLRQAAEPLGITVYPVGLDAEPQALPIAQSVITAEIERWPETALTR
ELADHRAFVNRDIFPLLADRLTQKQLLDRLGLATAPWQLLSSSDQWPQVFSDLGELAIVK
RRTGGYDGRGQWRLRVHETATLPGECYGDCIVERGINFSGEMSLVGARGHDGSTVFYPLT
HNLHQDGILRTSVVLPAVDAQHQQQAERMLSAIMNELNYVGVMAMECFVVPEGLLINELA
PRVHNSGHWTQNGASISQFELHLRAILNLPLPAPVVNTPAVMVNLIGTDLNTAWLSEPLV
HLHWYEKEVRAGRKVGHLNLADASPRALSSALTALVPMLPAEYASGIAWAVDKLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggtctgcgtattaggcaacggtcagctcgggcgcatgctgcgccaggccgct
gaaccgttggggatcaccgtttatccggtcggcctggatgccgaaccacaggcgctgccg
attgcgcaaagcgtcatcaccgccgagattgaacgttggccggaaaccgcgctgacacgg
gaactggccgatcatcgcgcctttgttaaccgcgatatcttcccgctgctggcagatcgc
ctgacgcagaagcagctgctcgaccgtctgggcctggcaacggccccctggcagctgctc
tcctcgtccgaccaatggccgcaggtgttttctgacctcggtgaactggcgatcgtcaaa
cgccgcaccggcggctacgacggccgtggccagtggcgtctgcgcgtccacgaaaccgct
acgctgccgggtgaatgttacggcgactgtatcgtcgaacggggtatcaatttttcaggt
gaaatgtcgctggtcggcgcgcgcggccatgacggcagcacggtgttctacccgctgact
cataacctgcatcaggacggtattctgcgcaccagcgttgtgctgccagccgtcgatgca
cagcaccaacagcaggctgagcgcatgctgtcggcgattatgaatgagctgaactacgtt
ggcgtcatggcgatggagtgctttgtggtgccggaaggcctgctgatcaatgagctggca
ccccgcgtgcataacagcggtcactggacgcaaaacggcgcgtccatcagccagtttgaa
ctgcatctgcgcgccattctcaacctgccgctgcctgccccggtggtcaataccccggca
gtcatggtcaacctgatcggcaccgatctcaatacggcatggctcagcgagccgctggtg
cacctgcactggtatgagaaagaggtgcgtgccgggcgtaaagtcggccatcttaacctg
gctgatgccagcccacgggcactgagcagcgcgctcactgctctggtgcccatgctgcct
gcggaatatgccagcggtatcgcctgggccgtggataaactcgcctaa

DBGET integrated database retrieval system