KEGG   Erwinia tasmaniensis: ETA_24430Help
Entry
ETA_24430         CDS       T00711                                 

Gene name
purK
Definition
(GenBank) Phosphoribosylaminoimidazole carboxylase ATPase subunit
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00230  Purine metabolism
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01130  Biosynthesis of antibiotics
Module
eta_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ETA_24430 (purK)
Enzymes [BR:eta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     ETA_24430 (purK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CAO97489
UniProt: B2VBE0
Position
2747687..2748754
Genome map
AA seq 355 aa AA seqDB search
MKPVCVLGNGQLGRMLRQAAEPLGITVYPVGLDAEPQALPIAQSVITAEIERWPETALTR
ELADHRAFVNRDIFPLLADRLTQKQLLDRLGLATAPWQLLSSSDQWPQVFSDLGELAIVK
RRTGGYDGRGQWRLRVHETATLPGECYGDCIVERGINFSGEMSLVGARGHDGSTVFYPLT
HNLHQDGILRTSVVLPAVDAQHQQQAERMLSAIMNELNYVGVMAMECFVVPEGLLINELA
PRVHNSGHWTQNGASISQFELHLRAILNLPLPAPVVNTPAVMVNLIGTDLNTAWLSEPLV
HLHWYEKEVRAGRKVGHLNLADASPRALSSALTALVPMLPAEYASGIAWAVDKLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggtctgcgtattaggcaacggtcagctcgggcgcatgctgcgccaggccgct
gaaccgttggggatcaccgtttatccggtcggcctggatgccgaaccacaggcgctgccg
attgcgcaaagcgtcatcaccgccgagattgaacgttggccggaaaccgcgctgacacgg
gaactggccgatcatcgcgcctttgttaaccgcgatatcttcccgctgctggcagatcgc
ctgacgcagaagcagctgctcgaccgtctgggcctggcaacggccccctggcagctgctc
tcctcgtccgaccaatggccgcaggtgttttctgacctcggtgaactggcgatcgtcaaa
cgccgcaccggcggctacgacggccgtggccagtggcgtctgcgcgtccacgaaaccgct
acgctgccgggtgaatgttacggcgactgtatcgtcgaacggggtatcaatttttcaggt
gaaatgtcgctggtcggcgcgcgcggccatgacggcagcacggtgttctacccgctgact
cataacctgcatcaggacggtattctgcgcaccagcgttgtgctgccagccgtcgatgca
cagcaccaacagcaggctgagcgcatgctgtcggcgattatgaatgagctgaactacgtt
ggcgtcatggcgatggagtgctttgtggtgccggaaggcctgctgatcaatgagctggca
ccccgcgtgcataacagcggtcactggacgcaaaacggcgcgtccatcagccagtttgaa
ctgcatctgcgcgccattctcaacctgccgctgcctgccccggtggtcaataccccggca
gtcatggtcaacctgatcggcaccgatctcaatacggcatggctcagcgagccgctggtg
cacctgcactggtatgagaaagaggtgcgtgccgggcgtaaagtcggccatcttaacctg
gctgatgccagcccacgggcactgagcagcgcgctcactgctctggtgcccatgctgcct
gcggaatatgccagcggtatcgcctgggccgtggataaactcgcctaa

DBGET integrated database retrieval system