KEGG   Erwinia tasmaniensis: ETA_24460Help
Entry
ETA_24460         CDS       T00711                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eta  Erwinia tasmaniensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ETA_24460 (tesA)
Enzymes [BR:eta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ETA_24460 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ETA_24460 (tesA)
Lipid biosynthesis proteins [BR:eta01004]
 Fatty acid synthase
  Component type
   ETA_24460 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2751937..2752539
Genome map
AA seq 200 aa AA seqDB search
MAFMTLRAAAADTLLVLGDSLSAGYRMSASAAWPALLNEKWQKSPAIINGSISGDTTAQG
LARLSALLEQHQPRWVLIELGGNDGLRGFPPQQVEQDLNQAIAQIQAAKAQPLLMQVRLP
ANYGKRYTDSFAAIYPRLASQHAIPLVPFFMEQVYLKPEWMQDDGIHPNPSAQPFIADLM
AKQLAPLVKHEASRSVGNDG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttttatgacgctgcgcgcggcggcggcggatacgctgctggtgctgggcgacagt
ctgagcgccggttaccgcatgtccgccagcgccgcgtggcccgcgttactcaatgagaaa
tggcaaaaatcccctgctatcattaacggtagcataagcggcgatacgacggcacaggga
ctggcccgactttcggcgctgctggagcaacatcagccgcgctgggtgctgattgaactg
ggtggcaacgacggtttacgtgggtttcctccgcagcaggttgagcaggatctgaatcag
gccattgctcaaatccaggcggcaaaggcgcagccgctgctgatgcaggtgcggctaccg
gccaactacggcaagcgctacaccgattcatttgccgccatttatcccagactggccagt
cagcatgcgatcccgctggtgccgttttttatggagcaggtctatctgaagccggaatgg
atgcaggacgacggcatccaccctaatccatcggcccagccttttattgccgatctgatg
gcaaaacagctggctcccttagttaagcatgaggcatcgcgtagcgtggggaatgacggg
taa

DBGET integrated database retrieval system