KEGG   Erwinia tasmaniensis: ETA_27520Help
Entry
ETA_27520         CDS       T00711                                 

Gene name
rocF
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00220  Arginine biosynthesis
eta00330  Arginine and proline metabolism
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01130  Biosynthesis of antibiotics
eta01230  Biosynthesis of amino acids
Module
eta_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    ETA_27520 (rocF)
   00330 Arginine and proline metabolism
    ETA_27520 (rocF)
Enzymes [BR:eta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ETA_27520 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAO97798
UniProt: B2VFW6
Position
complement(3066506..3067318)
Genome map
AA seq 270 aa AA seqDB search
MQVKIICSQGRVGDKTDATLRGAKLTADTLGRKFKRKISYIGKFSPCKNDQWKDSLPEAA
PTLALLQGELQQCLEQDNTPILALNTCSASLATLPIAAAKYPDMKLLWIDAHGDFNTPHT
TSTGYLGGMALAGACGLWDSGYGHGIRPEQVILIGAHDIDEAELLSLKQHSVRNIIPEKV
NPENVIKNIEGSKVWIHIDWDVLDPGQINADYKVKGGLPLSTLIDTLKAIPASQVLGLEI
AEFSPDENRPEQNEKDLINICDVVDALFLT
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaaaatcatttgttcacaaggacgcgttggggataaaacagacgctacgctt
aggggggcaaagcttaccgccgatacacttggaagaaaatttaaaagaaaaatcagctat
ataggtaagttctcgccctgtaagaatgatcaatggaaggactctcttcccgaagctgct
ccaacattagctctcctgcaaggagaactgcagcaatgtctggaacaagataatacccct
attctggccttaaacacttgttcagctagcctggccacattacccattgcggccgcaaag
tatccagacatgaaactgttgtggatagatgcccacggagattttaatactccacatacg
acttcaaccggttatctgggtggaatggccttagctggcgcctgtggcttatgggatagt
ggttatggtcatggtatcaggcctgagcaggtcattctgattggtgcacatgatatagat
gaagcagagcttttatcgctgaaacaacattcagtacgaaatattattccagaaaaagtg
aatccagaaaatgttattaaaaatatagaaggatctaaagtctggatacatattgactgg
gacgttctcgaccccggccagattaatgctgattacaaagttaaaggcggcctgcctctt
tccacactgattgatacacttaaggcaattccagccagtcaggttctggggcttgagatt
gcagagtttagtcctgacgaaaacaggcctgagcagaatgaaaaagatttaatcaatatc
tgcgatgtcgtagatgctttgttcttaacgtag

DBGET integrated database retrieval system