KEGG   Erwinia tasmaniensis: ETA_32250Help
Entry
ETA_32250         CDS       T00711                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eta  Erwinia tasmaniensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ETA_32250
Enzymes [BR:eta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ETA_32250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3590483..3592171
Genome map
AA seq 562 aa AA seqDB search
MNIINRLIGEIYGSTFPSGHLQRLHALIAAARTGIHPPRKAHWDEKDVVLITYADQVRED
NTPTLTTFSCFYRQYLQASFNLVHLLPFFPSSSDDGFAVIDYHQVNPPYGGWQEIADLHQ
HTRLMFDFVCNHMSAHSSWFSHYLAQDVGWDDFFISQPPTADLSAVTRPRTSPLLTPFVL
ADGKTRFIWTTFSADQVDLNYANPDVLLNMVRVLLDYLQRGADYLRLDAVGYMWKTPGTS
CIHLEKTHLLVKLFRAIIDKVAAGAVLLTETNVPHRDNIRYFGNGRDEAQMVYQFPLPPL
VLHAIHRGSSRALRHWASSLDGGGGSTTFFNFLASHDGIGLNPLRGILPEGEIIALAQDL
AQEGAQISWKTDTDGTSSPYEINVTYLDALNKQQDSDDTRLQRFLLAHGLLLAFPGVPAV
YVQSILGSRNDIEGMKVTGQNRAINRQKYALCDIRRALATTGSLRQRIYTALSQLIQVRK
GQPAFHPDNPMRLVDSDDTLLVMQRQAKDPQDTLWCVFNVSASTVSYRLPEPRDYHDAIG
GEKIDGKQDMALGAWQFRWLRA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatcaatagattaatcggcgagatttacggttccaccttcccgtcaggacac
ctgcaacggctgcacgccctgattgccgctgcccgcacggggattcacccgccgcgcaaa
gcgcactgggatgaaaaggacgtggtgctcatcacctacgcggatcaggttcgtgaagat
aacacccccaccctgaccaccttctcgtgcttctaccggcagtatttgcaggccagcttt
aacctcgtccatctgctgccctttttcccctcgtcgtcagacgatggctttgcggtgatt
gactatcaccaggtgaacccgccctacggcggctggcaggagatcgccgacctgcatcag
cacacgcgcctgatgtttgacttcgtctgcaaccatatgtccgcacacagttcctggttt
agccactatctggcgcaggatgtcggctgggatgatttttttatcagccagccacccacc
gctgatttatctgcggtgacccggccacgcacctcacctttgctcacgccgtttgtgctg
gcagacggaaagacgcgctttatctggaccaccttcagcgccgaccaggtcgatctgaat
tatgccaatcccgacgtactgctcaatatggtcagggtgttgctggattatttgcagcgg
ggagcagattatctgcggctggatgcggtgggctatatgtggaagacaccgggaacgtcg
tgcatccatttggagaaaactcatctgctggtgaagctgttccgcgccatcatcgataag
gtggccgcaggcgcggtgttattgaccgaaacgaacgtgccgcatcgtgacaatatccgc
tatttcggcaacggccgcgacgaggcgcagatggtctatcagtttccgttgccgccgctg
gtgctgcacgccatccaccggggatcgtcacgcgcactgcgccattgggcttcctcactt
gacggcggcggcggtagcaccaccttctttaattttcttgcttctcatgacggtatcggc
ctgaatcctctgcgcggcattttacctgaaggcgaaatcattgccctggcgcaagatctg
gcgcaagagggagcgcagatctcctggaaaacggatactgacggcacctccagcccctac
gaaattaacgtcacctatctggacgcgctgaataaacaacaggatagcgatgatacccgc
ctgcaacgttttctgctggctcacgggctgctgctggcttttcctggcgtgccggcggtc
tacgtgcagagtattctcggctcgcgcaatgatatcgagggcatgaaggtgacaggacaa
aaccgggcgatcaaccgtcaaaaatatgcgctgtgcgatatccgccgggcgctggcgaca
acgggctcgttacgccagcggatctataccgcgctcagccagctgattcaggtgcgtaag
ggtcagcctgccttccacccggacaatcccatgcgacttgtcgacagcgatgacacgctg
ttggtaatgcaaaggcaggcgaaagacccacaggatacgctgtggtgcgtgttcaatgtg
agcgccagcacggtcagctaccgtctgcctgaaccgcgcgactaccacgatgcgatcggc
ggcgaaaaaatcgatggtaagcaggatatggcgctgggcgcatggcagtttcgctggctc
agggcctga

DBGET integrated database retrieval system