KEGG   Erwinia tasmaniensis: ETA_33880Help
Entry
ETA_33880         CDS       T00711                                 

Gene name
celY
Definition
minor endoglucanase Y (Endo-1,4-beta-glucanase Y) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eta  Erwinia tasmaniensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eta00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3776895..3777896)
Genome map
AA seq 333 aa AA seqDB search
MMAMFRTGLLLLALMLGMAQAAAADGWSSFKLRFMTSDGRIQDTGNQNVSHTEGQGYAML
MAVYYDDRSSFDKLWRWTQNNLSNPKNGLFYWKYNPAARDPVSDKNNAADGDVLIAWALL
QAGEKWQVAGWLQQSDRIQRAIVAHNVIVFGGRTLMLPGAEGFNKTSYVVLNPSYFVFPA
WRDFARRSHLKLWDKLIKDGLDLLTEMRFGDTALPLDWVAMNVDGSLAPATAWPARFSYD
AIRIPLYLHWYDAASLRLVPFQRFWMGFPRLQTPAWIDVLTNEKAPYNMAGGLLAVRDLT
LDDAGYLNDSPGASEDYYSSSLQLLAWLAFKSR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaatgttcaggacgggcttgctgctgctggcgctgatgctgggaatggcccag
gcagccgcagccgatggctggagcagctttaaacttcgctttatgaccagcgacgggcgc
attcaggatacgggtaatcagaacgtcagccacacggaaggtcagggctatgcgatgctg
atggcggtgtattacgacgatcgcagcagctttgacaagctgtggcgttggacgcaaaac
aacctgagtaacccgaaaaatggcctgttctactggaaatacaatcctgcggctcgcgat
cccgtcagcgacaaaaataatgccgccgatggtgatgtactgattgcctgggcgctgctg
caggcgggtgaaaagtggcaggttgccggctggctacagcagtcagaccgtattcagcgc
gccattgtcgcccataacgtgatcgtctttggcggccgcaccctgatgctgcctggcgca
gagggctttaataaaaccagttacgtggtgctgaatccctcctactttgtcttccccgcc
tggcgggattttgcccggcgcagccatttaaaattgtgggataaactgattaaagatggg
ctggatttactgaccgaaatgcgcttcggcgacaccgctttaccgctggactgggtggcg
atgaacgtcgacggctcgctggctccggccaccgcctggcccgcgcgttttagttatgat
gcgatccgcattccgctgtacctgcactggtatgatgcggcttctctgcgcctggtgccg
ttccagcgtttctggatggggttcccgcgtctgcaaactccggcatggattgatgtgctg
acaaatgagaaagccccctacaatatggcgggtggcctgctggcggtacgcgatttaacg
ctggatgacgccgggtatctcaacgattcgccgggtgccagcgaagactactattcgtcg
agtctgcaattgctggcgtggctggcgtttaaaagccgctaa

DBGET integrated database retrieval system