KEGG   Erwinia tasmaniensis: ETA_pET090040Help
Entry
ETA_pET090040     CDS       T00711                                 

Gene name
res
Definition
DNA restriction subunit type III restriction and modification system
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
eta  Erwinia tasmaniensis
Brite
Enzymes [BR:eta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     ETA_pET090040 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pET09:3670..6306
Genome map
AA seq 878 aa AA seqDB search
MAKTPKSAGSEKLLFNKLKQFDEPGLFHDHYETPGYVQENLKDALRPYQHGALRYLHYTQ
RKREEALLHYRHLLFHMATGAGKTMVMAGTILYLFKEYGYQNFIFFVHTDAIIQKTRENL
LNPQSPKYLFSQELEIDGEKITIAPVETFPSVPERNTIYLKLSTIHKMHDELNSYRENSI
TYEDLKEIPLVLLGDEAHHFNAGTKAKGKLKTSPENEEQTWESTIENVLALRPDNRLFEY
TATIDLANKDIGNKYRDRVVYQYDLKQFMSDGYSKKVMLLEANQNDGDKMLDAVLLSQYR
KLVAADNGITGFKPVILFKSNKIAISKVKQEEFSQLIAAMTPESVRRHMANKKVQLSSDT
SIWHKVIQRYADSDLVTVIGQIQEDFNDFNLLNVNKSDLLEENPVLLNTLENTDNPVRAV
FAVAKVNEGWDVLNLYDIVRISEQASSSKTGTDSEAQLIGRGARYFPFMYDGKRSFTRRF
DTSAKDLSVLEQLHYHTINEPAYIKTLHASLEQADIDVHQDGGGTIEHARLKEDFKKSAV
YQTGRLYFNEVEEIESSSRNWETYSLETRFEIPYQTAGEESLDNLTGTTTGMTKPEPLIL
DERFYRKAMQRVSFYALDNLQRFFPKLTGIREFIRSDAYLGKLIITVTVPQSLDFSAVPA
KEKLHLLETVLLRLSENVRRNDQKVKGTYRFISQPVKEVIKDYSLHIDPSVVINQKITAA
QTIGKKWYVYDNAILNQLEHRLVKTLETFMPKLRARYDDIYVLRNDEQSTRFKLTEFGGV
RGFMPDFIMILTRNADNAYWQVFLEPKGDDRLLDDAWKERMLETLNDRERIVIDENEDVR
LVGIKFFANSQMDAFVSDMQNRLNDGESLETASISLPM
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacaccgaagtcagccggcagcgagaagctgctgtttaacaaactgaagcag
tttgatgaaccgggtctgttccatgaccactatgagacaccgggctacgttcaggaaaac
ctgaaggatgccctgcgcccgtaccagcacggggcgctgcgctacctgcattacacgcag
cgcaaacgtgaagaggcgctgctgcattaccggcatctgctgtttcacatggcaactggt
gccggaaagacgatggtgatggcggggacgatactctatctgtttaaagagtacgggtat
cagaacttcatcttcttcgtacataccgacgcgattatccagaaaacccgtgagaacctg
cttaacccgcagtcgccgaagtacctgttcagtcaggagctggaaatcgacggggaaaaa
atcaccatcgcaccggtggagacgttcccgtctgtgcctgaacgcaacacgatttacctc
aagctctcaaccatccacaagatgcacgacgagctgaacagctatcgtgagaacagcatc
acctacgaggatttgaaagaaatcccattagtccttctcggtgatgaagcgcatcacttc
aacgccggaacgaaagcgaaaggcaagttgaaaacctcaccggaaaacgaggagcagacc
tgggaaagcacaattgagaacgtcctcgctctgcgaccggataaccgcctgttcgagtac
accgccaccattgacctggcgaacaaagatatcgggaataaataccgtgacagggtggtg
tatcagtatgacctgaagcagttcatgtcagacggttactcgaaaaaggtcatgctgctg
gaagcgaatcagaacgacggcgacaagatgctcgatgccgtgctgttaagccagtaccgc
aaattggtggcagcggataacggcatcaccggcttcaagccggttattctgttcaagtcg
aacaagattgcgatatcaaaggtgaagcaggaggagttttcgcaactgattgcggcaatg
acacctgagagcgtcagacgccatatggcgaataaaaaagtccagctcagctctgacacc
agtatctggcacaaagtgattcagcgttacgctgacagcgatttagtgacggttataggg
cagatccaggaagactttaacgacttcaacctgctgaacgtcaacaagtcagatctgctg
gaagaaaaccccgttctgctgaacacgctggaaaacaccgataatccggtgagagccgtc
ttcgccgtggcgaaggtcaacgaaggctgggacgtcctcaacctctacgatatcgtccgc
atcagcgagcaggcgagcagcagcaaaaccggcacggacagcgaggcgcagcttatcggg
cgcggtgcgcgttacttcccgttcatgtatgacggaaagcggagcttcacccgtcggttt
gataccagcgcaaaggatttgagcgtgctggaacaactgcactatcacaccatcaatgag
ccggcgtacatcaaaacgctgcacgcctcccttgagcaggcggacatcgacgtgcatcag
gacggcggcggcacgattgagcacgccagactgaaagaggactttaaaaagtccgccgtg
tatcagaccggtaggctgtactttaacgaagtggaagagattgagagcagcagccgcaac
tgggaaacctactcgctggaaacgcgctttgagataccgtatcagaccgccggtgaggag
tcgctggacaacctgacgggcacaacgactgggatgacaaaacctgaacccctgatactg
gacgagcgcttttatcgcaaggcgatgcagagagtgagcttctacgccctggacaatctg
caacgattcttcccgaaactgaccggtatccgtgagttcatccgcagtgacgcctatctg
gggaaactgataatcaccgtcaccgtgccgcagtcgctggatttctccgccgtgccggca
aaagagaagctgcacctgctggaaaccgttctgctgcgtctctcagagaacgtgcgccgc
aatgaccagaaggtgaagggcacgtaccgctttatcagccagccggtgaaagaggtgatt
aaagactacagcctgcacattgacccgtcggtagtcattaaccagaaaatcaccgccgca
cagaccatcggtaaaaaatggtacgtgtacgataacgcgatactgaaccagcttgagcat
cgtctggtgaaaacgctggaaacctttatgccgaagctcagagcgcgttacgacgatatt
tacgtgctgcgtaatgacgagcagtcaacgcgctttaagctcacggagttcggcggcgtg
cgcggctttatgccggatttcatcatgatactgacgcgcaatgcagataacgcttactgg
caggtattccttgagccgaaaggggatgaccgcctgctggatgacgcctggaaagaaagg
atgctcgaaaccctgaatgacagggaacgcattgtgattgatgagaatgaggatgtcaga
ctggtcggaattaaattctttgccaacagccagatggatgccttcgtcagcgacatgcag
aaccggctgaacgacggcgaatcgcttgaaaccgcctcgatctccctgcctatgtaa

DBGET integrated database retrieval system