KEGG   Edwardsiella tarda C07-087: ETAC_00435Help
Entry
ETAC_00435        CDS       T02509                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
etc  Edwardsiella tarda C07-087
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:etc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(95972..96718)
Genome map
AA seq 248 aa AA seqDB search
MSILVTRPSPAGEQLVERLRALGMEAWHTPLIDVAPGRQLALLPEAVAALQRGDLLLAVS
RHAVLYAAEALRLAGRGWPTTPRYAAIGHSTAQSLGAACHQPVIFPPAPETSEALLALPA
IRQLRARRALILRGNGGRDLIADALRARGVSVTLCECYRRVAIAYPGDELCARWRQQKVS
TLVVTSGEMLQQLYDLVPEYDRQRWLLSCRLIVVSERLAQRARDLGWQEIRVAESANNDA
LLRTLQIN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctggtgacccgcccctcccccgccggtgaacagctggtcgagcgcctgcga
gcgctggggatggaggcgtggcatacgccgctgatcgacgttgcccccggtcggcagctg
gcgctgctgccggaggccgtggccgcgctgcagcggggcgatctgctgctggccgtctct
cgccacgccgtcctctacgccgcagaggcgctgcgactggccggtcgcggctggcccacg
accccgcgctacgccgctatcgggcacagtaccgcacagtcgctaggggccgcctgtcac
caaccggtgatctttccgccagcgccggaaacctcggaggcgctgctggcgctgcccgcc
atacggcagctgcgggcccggcgggccctgatcctgcgcggtaacggcgggcgcgacctg
atcgccgatgccctgcgcgcgcgcggcgtttcggtcaccctatgcgaatgctatcgccgg
gtcgccatcgcctaccccggtgacgagctctgcgcgcgctggcggcaacagaaagtctcg
acactggtagtgaccagtggtgaaatgctgcaacagctctatgatttagttcctgaatac
gatcggcaacgttggctcctcagctgccggctgatcgtcgtcagcgaacgtctggcacag
cgcgcccgggatctgggatggcaggagatccgggtggcggaaagcgccaacaatgatgcg
ctattgcgtacgctacagatcaactga

DBGET integrated database retrieval system