KEGG   Edwardsiella tarda C07-087: ETAC_02360Help
Entry
ETAC_02360        CDS       T02509                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
etc  Edwardsiella tarda C07-087
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:etc00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543258..544580
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSEEEIRFFINGIRDNTISEGQIAALAMTIFFHDMAMPERVALT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGFDIFPDDSRFRSIIADVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTFALSEALAQAIVGVANGAGCRTTALLT
DMNQVLASSAGNALEVREAVQFLTGEARNPRLFEVTMALCVEMLISGKLAADQTEARNKL
QAVLDNGKAAEIFGRMVAAQSGPCDFVERYDHYLPQAVLCKPVFAEQAGIITAMDTRALG
MSVVGLGGGRRQASDSIDYSVGLTEMVRLGDSVDGQRPLAVVHARDEASWQQAAEAVRAA
VTLGERAPEPTPVVYRRITQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggctcaagaaattatccgcaaaaagcgcgacggccatgcgctgagcgaagaa
gaaattcgctttttcatcaacgggatccgggataacacgatctccgagggacagatcgcc
gcgctggcgatgacgatctttttccacgatatggccatgccggagcgcgtggcgctgacc
atggcgatgcgggactctggcaccgtgctggactggaagtccctgaatctgaacgggccg
attgtcgataagcattcgaccggcggcgtgggggacgtgacctcactgatgctggggccg
atggtcgccgcctgcggtggctatgtgccgatgatctccggtcgcggcctcgggcatacc
ggcggcacgctggataagctagaatcgatcccagggttcgacattttcccggacgacagc
cgtttccgcagcattatcgccgatgtcggcgtcgccattatcgggcagaccagctcgctg
gcgccggcggataagcgtttttatgcgacgcgcgatatcaccgcgacggtcgactctatc
ccgctgatcaccgcctctattctggccaagaagctggccgaggggctggatgcgctggtg
atggatgtgaaggttggctccggcgcctttatgccgacgttcgcgctgtctgaggcgctg
gcgcaggcgatcgttggcgtggccaacggcgcaggctgccgcaccacggcgctgctgacc
gacatgaatcaggtgctggcctccagcgccggtaacgcgttggaagtgcgcgaggcggtg
cagttcctgacgggcgaggcgcgcaatccgcgtctgttcgaggtcaccatggcgctgtgc
gttgagatgctgatctccggcaaactggccgcagatcagacggaggcccgcaataagctg
caggcggtactcgacaacggtaaggcggcagagatctttggccgaatggtggcggcgcag
agcggtccgtgtgacttcgttgagcgctatgaccactatttgccacaggcagtgctgtgc
aaaccggtatttgccgaacaagctggtattatcacagcaatggacacccgtgcgctgggg
atgtccgttgtcgggctgggcggcggtcgccgtcaggccagcgatagcattgattacagc
gtagggctaaccgagatggttcgtctgggtgattcggtcgatgggcagcgcccgctggcc
gtggttcatgcccgcgatgaagcgagctggcagcaggccgccgaggcggtgcgcgccgcg
gtgacgctgggagagcgtgcgcctgagccgacgccggtggtgtatcgccgtatcacgcag
taa

DBGET integrated database retrieval system