KEGG   Edwardsiella piscicida C07-087: ETAC_07075Help
Entry
ETAC_07075        CDS       T02509                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ETAC_07075
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ETAC_07075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1610025..1610612
Genome map
AA seq 195 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYRERGMHTLVFTAEIDNRYAVGQVSSRIGLHSPAM
LYNQQTDLLAEIHQAHRQQCVHCVLVDESQFLTKAQVLALSTVVDDLDIPVLCYGLRTDF
RAELFPGSQYLLAWADKLVELKTICHCGRKANMVLRLDQDGRALKDGEQVVIGGNERYVS
VCRRHYKEMLGVTAP
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttttattactctgcaatgaatgccgggaaatccacggcgctgtta
cagtcctcttataactaccgcgagcggggtatgcataccctagtattcacggctgaaata
gataatcgctatgcggtggggcaggtcagctcgcgtatcgggctgcactcgcctgcgatg
ctgtataatcagcagaccgatctgctggctgagatccaccaggcgcatcggcagcagtgt
gtacactgcgttctggtcgatgaaagtcagtttctcactaaagcgcaggtgctggcgctg
tcgacggtggtcgatgatttagatattccggtgctgtgctacggcttacggaccgatttc
cgggcggaactctttcccggtagccaatatttgctggcctgggccgataagttggtagag
cttaagactatctgccactgtggccgcaaggcgaatatggtgctgcgtctggatcaggat
ggacgggcgctgaaagacggtgagcaggtagtgatcggcggtaatgagcgctatgtctcc
gtttgtcgtcggcattataaggaaatgctcggcgtgaccgccccgtaa

DBGET integrated database retrieval system