KEGG   Edwardsiella tarda C07-087: ETAC_10755Help
Entry
ETAC_10755        CDS       T02509                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
etc  Edwardsiella tarda C07-087
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:etc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:etc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2441764..2443074
Genome map
AA seq 436 aa AA seqDB search
MTRFDTLIQWDDCSPEQQQRLLQRPAIASAAQISASVETIIAQVRRDGDAALHRLSQRFD
REAPAILRVSRQTRDAAGDSLPDALTRAMRQAAENIEAFHYAQRPAPVDVETQPGVSCRQ
VTRALDSVGLYIPGGSAPLLSTVLMLGIPARVAQCRRVILCSPPPIDPAILYAARLCGID
EIFQVGGAQAIAAMAFGTESVPRVDKIFGPGNAYVTEAKRQVSQSPQGAAIDMPAGPSEV
LVIADAKANPDFIAADLLSQAEHGPDSQVILLTPDAPLARRVAERVEAQLAALPRADIAR
QALAQSRLIVTRSLAQCIEISNRYGPEHLIIQTRDAETWLDAITSAGSVFLGDWSPESAG
DYASGTNHVLPTYGYTATHSSLGLADFQKRMTVQRLSPAGLLTLAPTVEAMAQAECLDAH
ANAVRLRVAAIRESQS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctttgatacgcttatccaatgggacgactgtagccccgaacagcagcagcgc
ctgctacagcgcccggcgatcgccagcgccgcgcaaatcagcgcaagcgttgagacgatc
atcgcccaggttcgccgcgacggcgatgcggcgctgcatcgcctcagccaacgctttgac
cgggaggcccccgccatcctgcgcgtatcacgccagacccgcgacgccgccggcgacagc
ctgcccgacgcactgacccgcgccatgcgccaggcagccgagaatattgaggcctttcat
tacgctcagcgcccggccccggtcgacgtcgaaacccagcccggcgtcagctgccgccag
gtcacccgcgcgctggactccgtcgggctgtatattcccggcggcagcgcaccgctgctc
tccacggtgctgatgctggggatcccggcccgcgtggcgcagtgccgcagggtgatcctc
tgctcgccgccgccgatcgacccggcgatcctctacgccgcacgcctgtgcggcatcgac
gaaatctttcaggtcggcggtgcgcaggcgatcgccgccatggccttcgggaccgaatcc
gttccccgcgtcgacaaaatctttggcccaggaaacgcctatgtcaccgaggccaaaaga
caggttagccaaagccctcagggcgccgccatcgatatgcccgccggcccctccgaggtg
ctggtgatcgccgatgccaaggccaacccggactttatcgccgccgatctactctcccag
gcggagcatggccccgactcacaggtgatcctgctgacgcccgatgccccgctggctcgc
cgggtcgccgagcgggtcgaggcgcagcttgccgccctgccgcgcgccgacatcgcccgc
caggcgctggcgcagagccgcctgatcgtcacccgttcgctggcgcagtgcatcgagatc
agcaaccgctatgggccggagcacctcatcatccaaacccgcgacgccgagacgtggctc
gatgccatcaccagcgccggctccgtgtttctgggcgactggtcgcccgagtccgccggg
gactatgcctctggcaccaatcacgtgctgccgacctacggctacaccgccacccactcc
agcctgggcctggcggatttccagaaacgcatgaccgtccaacgcctcagccccgccggt
ctgctgacgctggccccgacggttgaggccatggcacaggccgagtgccttgacgcccac
gccaacgccgtccgtctgcgggtcgccgccatccgggagagccaatcatga

DBGET integrated database retrieval system