KEGG   Edwardsiella piscicida C07-087: ETAC_10755Help
Entry
ETAC_10755        CDS       T02509                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ETAC_10755
  Amino acid metabolism
   00340 Histidine metabolism
    ETAC_10755
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ETAC_10755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2441764..2443074
Genome map
AA seq 436 aa AA seqDB search
MTRFDTLIQWDDCSPEQQQRLLQRPAIASAAQISASVETIIAQVRRDGDAALHRLSQRFD
REAPAILRVSRQTRDAAGDSLPDALTRAMRQAAENIEAFHYAQRPAPVDVETQPGVSCRQ
VTRALDSVGLYIPGGSAPLLSTVLMLGIPARVAQCRRVILCSPPPIDPAILYAARLCGID
EIFQVGGAQAIAAMAFGTESVPRVDKIFGPGNAYVTEAKRQVSQSPQGAAIDMPAGPSEV
LVIADAKANPDFIAADLLSQAEHGPDSQVILLTPDAPLARRVAERVEAQLAALPRADIAR
QALAQSRLIVTRSLAQCIEISNRYGPEHLIIQTRDAETWLDAITSAGSVFLGDWSPESAG
DYASGTNHVLPTYGYTATHSSLGLADFQKRMTVQRLSPAGLLTLAPTVEAMAQAECLDAH
ANAVRLRVAAIRESQS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctttgatacgcttatccaatgggacgactgtagccccgaacagcagcagcgc
ctgctacagcgcccggcgatcgccagcgccgcgcaaatcagcgcaagcgttgagacgatc
atcgcccaggttcgccgcgacggcgatgcggcgctgcatcgcctcagccaacgctttgac
cgggaggcccccgccatcctgcgcgtatcacgccagacccgcgacgccgccggcgacagc
ctgcccgacgcactgacccgcgccatgcgccaggcagccgagaatattgaggcctttcat
tacgctcagcgcccggccccggtcgacgtcgaaacccagcccggcgtcagctgccgccag
gtcacccgcgcgctggactccgtcgggctgtatattcccggcggcagcgcaccgctgctc
tccacggtgctgatgctggggatcccggcccgcgtggcgcagtgccgcagggtgatcctc
tgctcgccgccgccgatcgacccggcgatcctctacgccgcacgcctgtgcggcatcgac
gaaatctttcaggtcggcggtgcgcaggcgatcgccgccatggccttcgggaccgaatcc
gttccccgcgtcgacaaaatctttggcccaggaaacgcctatgtcaccgaggccaaaaga
caggttagccaaagccctcagggcgccgccatcgatatgcccgccggcccctccgaggtg
ctggtgatcgccgatgccaaggccaacccggactttatcgccgccgatctactctcccag
gcggagcatggccccgactcacaggtgatcctgctgacgcccgatgccccgctggctcgc
cgggtcgccgagcgggtcgaggcgcagcttgccgccctgccgcgcgccgacatcgcccgc
caggcgctggcgcagagccgcctgatcgtcacccgttcgctggcgcagtgcatcgagatc
agcaaccgctatgggccggagcacctcatcatccaaacccgcgacgccgagacgtggctc
gatgccatcaccagcgccggctccgtgtttctgggcgactggtcgcccgagtccgccggg
gactatgcctctggcaccaatcacgtgctgccgacctacggctacaccgccacccactcc
agcctgggcctggcggatttccagaaacgcatgaccgtccaacgcctcagccccgccggt
ctgctgacgctggccccgacggttgaggccatggcacaggccgagtgccttgacgcccac
gccaacgccgtccgtctgcgggtcgccgccatccgggagagccaatcatga

DBGET integrated database retrieval system