KEGG   Edwardsiella piscicida C07-087: ETAC_14100Help
Entry
ETAC_14100        CDS       T02509                                 

Definition
protein disulfide isomerase II DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
etc  Edwardsiella piscicida C07-087
Brite
Enzymes [BR:etc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ETAC_14100
Secretion system [BR:etc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ETAC_14100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3182960..3183676)
Genome map
AA seq 238 aa AA seqDB search
MKKSVIWLALLAASVSGLARADDAAIQQSLKKLGIQQAQIQASPVAGLKTVFSEGGVLYV
TDDGKHILQGPMYDVSGAVPENVTNQLLMKRLDALAPEMIVYKAPKQKYVITVFTDITCG
YCHKLHSQIKEYNDLGITVRYLAFPRQGLDSKAEKDMQSIWCMADRRKAFDDALKGEAIS
PATCDVNIKSHYELGVQFGIQGTPAIVLSNGMVIPGYQGPKEMLAMLDAQAQMSQKKG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagcgtgatttggttggcattactggcggcatccgtcagcggcctggcccgg
gcagatgatgccgcgatccagcagtccctgaagaagctggggatccagcaggcgcagatc
caggcgtcgccggtggccggtctgaagacggtcttcagcgagggcggcgtgctgtatgtc
acggacgatggtaagcatatcctgcaggggccgatgtatgacgtcagcggcgcggtgccg
gaaaacgtcaccaatcagctgctgatgaagcgcctggacgcgctggcgccggagatgatt
gtctataaggcaccgaagcagaagtatgtgatcaccgtctttaccgatattacctgcggc
tactgccataagctgcactcccagattaaggagtacaacgatctggggatcaccgtgcgc
tacctcgccttcccgcgccaggggctggactccaaggcggagaaggatatgcagtcgatc
tggtgtatggcggatcgccgcaaggccttcgacgacgcgctgaagggggaggcgatttca
ccggcgacctgtgatgtgaacatcaagtctcactatgagctgggcgtgcagtttggcatt
caggggacgccggcgatcgtgctgagcaacgggatggtgatccctggctatcaggggccg
aaagagatgctggcgatgctggatgcccaggcgcagatgagccagaagaaaggttaa

DBGET integrated database retrieval system