KEGG   Edwardsiella piscicida C07-087: ETAC_15775Help
Entry
ETAC_15775        CDS       T02509                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:etc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ETAC_15775
Enzymes [BR:etc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ETAC_15775
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_15775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3562333..3564543
Genome map
AA seq 736 aa AA seqDB search
MSVLPSTHKIQQLLAGQCADPFALLGMHTTAKGLTVRALMPEAESVQVVDRKNGRTLATL
ERIHEGGFFCGLVPRRKNPFPYLLRVTWANHQQLLEDPYRFGPLLGEIDNWLLKEGTHLR
PYERLGAHLTQLADIRGVSFAVWAPNAQRVSVVGNFNVWDGRRHPMRLRRESGIWELFIP
GVEAGELYKFELIDARGERVLKADPYAFEAQMRPDTASLVAPLPEKSAISAQRSAANGFS
APISIYEVHLGSWRRHSDNGYWLSYREMAEQLIPYVKEMGFTHIELLPINEHPFDGSWGY
QPLGLYAPTRRYGTPQEFREFIDAAHAAGINVLLDWVPGHFPSDEWGLANFDGTALYEYA
DPREGFHQDWNTLIYNYGRYEVRNFLAGNALFWQERYGIDGLRVDAVASMVYRDYSRAAG
EWVPNCHGGNQNLEAIEFLRYTNRTLGEQHPGSVCMAEESTDFPGVTLPPDAGGLGFHFK
WNMGWMHDTLNYMKHDPVYRKYHHNLMTFGLLYAWSENFVLALSHDEVVHGKGSLLDKMP
GDAWQKFANLRAYYGFMWAHPGKKLLFMGGEFAQGREWNHESSLDWHLLEGEDNWHNGVQ
RLVRDLNLCYRSCGALHRWDCDARGFRWRVVDDDQNSVFAFVRRDDMGNEVLVVSNFTPV
PRHHYRIGVDLPGRYREILNTDSSHYHGSNSGNQGGVLSEAVGSHGCEYSVQLTLPPLST
LYLCLDNGDGDDAQAG
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtacttcccagcactcacaagatccaacaactgctcgccggccagtgcgccgat
cccttcgctctgctggggatgcacacgaccgctaaagggctgaccgtgcgggcgctgatg
cccgaggcagaatcggtacaggtggtcgaccgtaaaaacgggcgcacgctggccacgctg
gagcgtatccatgagggcggtttcttctgcggcctggtgccgcggcgtaagaatcccttc
ccttatctgctgcgcgtcacctgggccaatcatcagcagctgctggaagatccctaccgt
ttcgggccgttgttaggcgagatcgataactggctgctcaaagagggtacccatctgcgt
ccctatgaacgactgggcgcccacctgacccagttggccgatatccgcggcgtcagcttc
gccgtctgggcacccaacgcccagcgcgtctcggtggtcggcaactttaacgtctgggac
gggcgccgccatccgatgcgcctgcgtcgggaaagcggtatctgggagctgttcatcccc
ggcgtagaggcgggtgagctgtacaagtttgagctgatcgacgcccgcggcgagcgggtg
ctgaaagccgatccctacgcctttgaagctcagatgcggccggataccgcctcgctggtc
gctccgctaccggaaaaaagcgccatcagcgcccagcgcagcgccgccaatggcttcagc
gccccgatctccatctatgaggtacacctcggctcctggcgacgccacagcgacaacggc
tactggctgagctaccgggaaatggccgagcagctcatcccctacgtcaaagagatgggc
tttacccatatcgagctgctgccgatcaatgagcacccctttgacggctcctggggctat
cagccgctggggctatacgcgccgacccgacgctatggcacgccgcaggagttccgtgaa
tttatcgacgccgcccacgccgccgggatcaacgtcctgctcgactgggttcccggccac
tttcccagcgacgagtgggggctggctaacttcgacggcacggcgctgtatgaatacgcc
gatccgcgcgaaggcttccaccaagactggaataccctgatctacaactatggccgctat
gaggtgcgtaacttcctggccggcaacgccctcttctggcaggagcgctatggcatcgac
ggcctgcgcgtcgacgccgtggcctccatggtctaccgcgactacagccgcgccgcgggc
gaatgggttcccaactgccacggcggaaaccagaatctggaggccatcgagttcctacgc
tataccaaccggaccctgggcgagcaacaccccggcagcgtctgtatggccgaagagtcc
accgactttcccggcgtcaccctgccgccggacgccggcggcctgggcttccacttcaag
tggaatatgggctggatgcacgacaccctcaactacatgaagcacgatccggtctatcgc
aaatatcaccacaatctgatgaccttcggcctgctgtatgcctggagcgaaaactttgtg
ctggccctctcccacgacgaagtcgtgcacggcaagggctcgctgctggataaaatgccc
ggtgacgcctggcagaaatttgccaacctgcgcgcctactacggctttatgtgggcgcat
cccggtaaaaagctgctgtttatgggcggggagtttgctcaggggcgcgaatggaaccac
gagtccagcctggactggcacctgctagagggcgaagacaactggcacaatggcgtccag
cggctagtacgggatctgaacctctgctatcgcagctgcggcgcactgcaccgctgggac
tgcgacgcgcgtggcttccgctggcgagtggtcgatgacgatcagaactcggtcttcgcc
tttgtccgccgcgacgatatgggcaacgaagtgctggtggtcagtaactttacgccggtc
ccgcgtcatcactaccgtatcggcgtcgatctgccggggcgctatcgcgaaattctcaat
accgactccagccactaccacggcagcaacagcggtaatcagggcggcgtgctcagcgag
gcggtgggcagccacggctgtgagtactccgtccagctgaccctaccgccgctgtcgacg
ctctatctgtgtctggataatggggacggagacgatgctcaggccgggtaa

DBGET integrated database retrieval system