KEGG   Edwardsiella tarda C07-087: ETAC_16135Help
Entry
ETAC_16135        CDS       T02509                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
etc  Edwardsiella tarda C07-087
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:etc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3650829..3651950)
Genome map
AA seq 373 aa AA seqDB search
MKESVCRTLMAAALLCVSVATVGAPCEWHEWEQFRQGYISPDGRVIDPSSPRQITTSEGQ
SYALFFALVNNDRPLFANLLAWTQNNLAQGSLRQHLPAWKWGRHDDGRWRILDNNSAADA
DLWIAYALLEAGRLWQDADYQHLGIQLLARIAREEVVSLPGFGMMLLPGRQGFRSGALWT
VNPSYLPPQILARIAPLHGPWNRLQYSALRMLEASSPQGIVPDWTNWQRNKGWLPTPGRA
YISGYDAIRAYLWAGMLADGAPAKSALVKHWQPMVALSERLGYIPEKVSVLGAQPQGEGN
VGFSAAMLPFLDASNSPLLAAQRQRVKDNPPGNNNYYSSVLTLFGLGWDQRRYRFNLQGE
LVPNWGAVCDVSD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagtcggtctgccgtacattgatggctgccgcattgctgtgtgtcagcgtcgcc
accgtaggcgcgccctgtgaatggcatgagtgggaacagtttcgtcagggctatatcagc
cctgacgggcgggttatcgatcccagctctccccgccagataaccacctcggaggggcaa
agctatgcgctgttctttgccctggtcaataacgatcgcccgttgttcgctaatctattg
gcctggacgcagaataacctggcgcagggcagcctgcgccagcatttgccggcctggaag
tgggggcgccatgatgacgggcgctggcgcatattggataacaactccgccgcggatgcc
gacctgtggatagcctatgcgctgctggaggccggacgcctgtggcaggatgccgattac
caacatttgggcattcagctgctggcgcggattgcccgggaggaggtggtctcgctgccg
gggtttggcatgatgctgctgccgggtcgccaggggttccgctccggcgccctgtggacg
gtaaatccaagctatctaccaccgcagatcctggcccggattgcgccgttgcatgggccg
tggaatcgcctgcagtacagcgcgctgcgtatgttagaggcgtcgtcgccgcagggtatc
gtgccggattggaccaactggcagcggaataagggctggctgccgacgccggggcgggcc
tatatcagcggctatgatgctatccgggcctatctgtgggcgggaatgctggccgacggc
gcgccggccaaaagcgcgctggtgaagcactggcagccgatggtggcgctgagtgagcgt
ctgggatatatccctgaaaaggtcagcgtgctgggcgcgcagccccagggcgaaggcaac
gtcgggttctctgccgccatgctaccgtttctggacgccagcaacagcccgctattggcg
gcgcagcgccagcgggtaaaagacaacccgccggggaataataactactacagttcagtc
ctgacgctgtttggcctgggatgggatcagcggcgttaccgttttaatctacagggcgaa
ctggtgccaaactggggtgccgtatgcgatgtttccgactga

DBGET integrated database retrieval system