KEGG   Edwardsiella tarda FL6-60: ETAF_0031Help
Entry
ETAF_0031         CDS       T02091                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00230  Purine metabolism
etd01100  Metabolic pathways
Module
etd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ETAF_0031
Enzymes [BR:etd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ETAF_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 RsgA_GTPase ABC_tran AAA_22 CPT MMR_HSR1 Viral_helicase1 AAA_29
Motif
Other DBs
NCBI-ProteinID: ADM40154
UniProt: A0A0H3DNN4
Position
complement(32803..33426)
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPTYDSRVSVSHTTRASRPGEQHGEHYYFVSVD
EFKAMIARDDFLEHAEVFGNYYGTSRQAIEKVLAQGIDVFLDIDWQGARQVRSKMPQARS
IFILPPSREELARRLHGRGQDSDDVIAGRMAKAVSEMSHYSEYDYLIINDDFDVALQDLR
TIIRAERLRRERQQLRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaggtacgctctatatcgtttccgcgccgagcggcgctggcaaatccagcctg
atccaggccctgctgaaaacgcagccgacctacgactcccgggtttccgtctcgcacacc
acgcgcgccagccgtccgggcgaacagcacggtgagcattactactttgtctctgtggac
gagttcaaggcaatgatcgcccgcgatgatttcctggagcacgccgaagtctttggcaac
tactatggcacctcgcgtcaggcgattgaaaaggttctggcgcaggggatcgatgttttc
ctcgatatcgactggcagggcgcccgccaggtgcgcagcaagatgccgcaggcccgcagc
atcttcattctgccgccgtcgcgcgaggagctggcgcgccgtctgcacggtcgcgggcag
gacagcgatgacgtcatcgccgggcgtatggccaaggcggtcagcgaaatgtcgcactat
agcgagtacgactacctcatcatcaacgacgacttcgacgtcgcgcttcaggatctgcgc
accatcatccgcgccgaacgcctgcgccgcgagcgtcagcagctgcgtcatgatgcttta
atcagcaaattattggcagactga

DBGET integrated database retrieval system