KEGG   Edwardsiella tarda FL6-60: ETAF_0089Help
Entry
ETAF_0089         CDS       T02091                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAF_0089
Enzymes [BR:etd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ETAF_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(95963..96709)
Genome map
AA seq 248 aa AA seqDB search
MSILVTRPSPAGEQLVERLRALGMEAWHTPLIDVAPGRQLALLPEAVAALQRGDLLLAVS
RHAVLYAAEALRLAGRGWPTTPRYAAIGHSTAQSLGAACHQSVIFPPAPETSEALLALPA
IRQLRARRALILRGNGGRDLIADALRARGVSVTLCECYRRVAIAYPGDELCARWRQQKVS
TLVVTSGEMLQQLYDLVPEYDRQRWLLSCRLIVVSERLAQRARDLGWQEIRVAESANNDA
LLRTLQIN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctggtgacccgcccctcccccgccggtgaacagctggtcgagcgcctgcga
gcgctggggatggaggcgtggcatacgccgctgatcgacgttgcccccggtcggcagctg
gcgctgctgccggaggccgtggccgcgctgcagcggggcgatctgctgctggccgtctct
cgccacgccgtcctctacgccgcagaggcgctgcgactggccggtcgcggctggcccacg
accccgcgctacgccgctatcgggcacagtaccgcacagtcgctaggggccgcctgtcac
cagtcggtgatctttccgccagcgccggaaacctcggaggcgctgctggcgctgcccgcc
atacggcagctgcgggcccggcgggccctgatcctgcgcggtaacggcgggcgcgacctg
atcgccgatgccctgcgcgcgcgcggcgtttcggtcaccctatgcgaatgctatcgccgg
gtcgccatcgcctaccccggtgacgagctctgcgcgcgctggcggcaacagaaagtctcg
acactggtagtgaccagtggtgaaatgctgcaacagctctatgatttagttcctgaatac
gatcggcaacgttggctcctcagctgccggctgatcgtcgtcagcgaacgtctggcacag
cgcgcccgggatctgggatggcaggagatccgggtggcggaaagcgccaacaatgatgcg
ctattgcgtacgctacagatcaactga

DBGET integrated database retrieval system