KEGG   Edwardsiella tarda FL6-60: ETAF_0102Help
Entry
ETAF_0102         CDS       T02091                                 

Definition
Phospholipase A1 precursor; Outer membrane phospholipase A (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ETAF_0102
   00565 Ether lipid metabolism
    ETAF_0102
   00590 Arachidonic acid metabolism
    ETAF_0102
   00591 Linoleic acid metabolism
    ETAF_0102
   00592 alpha-Linolenic acid metabolism
    ETAF_0102
Enzymes [BR:etd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ETAF_0102
    3.1.1.32  phospholipase A1
     ETAF_0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110130..111017
Genome map
AA seq 295 aa AA seqDB search
MNACKKYLMAGVAALPLVAQAAPSASESGAAPALSDNEGVIANMLRHYDNPFTLYPYSTN
YVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISLAFPIWRGIAGDNSVLGAAYTQQSWW
QAFNRSESSPFRETNYEPRLFLGWATDYPLFGGWVLRDIEAGGVHQSNGRSDPTSRSWNR
VYTRFLAQNGNFQVQLMPWYRIPESPNKDDNPDITKYMGYYEAEMGYRLGESVFSLRGRY
NWNSGYGAAELGWSYPLTRHVRFYTQLFSGYGESLIDYNFRQTRFGVGVMLNDIL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgtgtaaaaaatatttaatggccggagtggcggcgttgccactggtggcgcag
gcggcgccgagtgcgagtgaaagcggtgcggctcccgcgctgagtgataatgagggggtg
atcgccaacatgctgcggcattacgataacccgtttacgctctatccttactccaccaac
tatgtgctgtatacccagaccagcgatatcaataaagaggccatcagctcttacgactgg
ggcgatcaggctaaaaagaacgagattaagtttcagattagcctggcattccccatctgg
cgcggtatcgccggcgataactcggtgctcggcgcagcctacactcagcagtcctggtgg
caggcctttaaccgcagcgaatcttctccgtttcgcgaaaccaactatgagccgcgcctg
tttttaggctgggcgaccgactatcccttgttcggcggctgggtgctgcgcgatattgag
gcgggcggagtgcaccagtctaatggccggtcggatccgacctcgcgcagctggaaccgc
gtctatacccgttttctggcgcagaacgggaattttcaggttcagctgatgccgtggtat
cgcattccggagagtccgaacaaggacgataaccccgatatcaccaagtacatgggctac
tacgaagcggagatgggctatcgcctgggcgagagcgtcttcagcctacgtgggcgctac
aactggaacagcggctatggcgcggccgagctgggctggagctatccgctgacccgccac
gtccgtttctatacccagctgttcagcggctacggcgagtcgttaatcgactataacttc
cgccagacccgcttcggcgtcggcgtcatgctgaacgatatcctgtaa

DBGET integrated database retrieval system