KEGG   Edwardsiella tarda FL6-60: ETAF_0252Help
Entry
ETAF_0252         CDS       T02091                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ETAF_0252
Enzymes [BR:etd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     ETAF_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(296505..298286)
Genome map
AA seq 593 aa AA seqDB search
MNKQHSLPKVGIRPAIDGRRMGVRESLEAQTMEMAQATARLISEQLRHPCGAPVECVIAD
TCIAGMAEAAACEEKFSRSNVGLTITVTPCWCYGSETIDMDPLRPKAIWGFNGTERPGAV
YLAAALAAHSQKGIPAFSIYGHDVQDSGDDSIPADVQQKLLRFTRAGLAVAGIKGKSYLS
LGGVSMGIAGSIVDHDFFESWLGMKVQAVDMTELRRRIDNQIYDQDELALALEWADAHFR
YGPDLNAEQYRRSPEENRRVLRESLLMAICIRDMMQGNPKLAERGWEEEALGYNAVAAGF
QGQRHWTDQYPNGDTAEALLNSAFDWHGVRRPLVVATENDSLNGVAMLFGHMLTGTAQIF
ADVRTYWSPQAVERVTGQRLEGLAEHGIIHLINSGSAALDGTCRQQDAEGHPTIKPHWQI
SQQEADACLAATEWCPAIHEYFRGGGFSSRFLTRGGVPFTMSRVNLIKGVGPVLQIAEGW
SVELPEEMHDILDNRTNATWPTTWFVPRLTGNGPFKDVYSVMANWGANHGVLTIGHVGAD
LITLASMLRIPVCMHNVTDDAIYRPSAWAAHGMDSEGQDYRACQNYGPLYKRA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcaacacagcctgccgaaagtaggtatccgtccggccatcgatggccgccgt
atgggcgttcgcgaatcgctggaggcacagaccatggagatggcgcaggcgaccgcccgc
ctgatcagcgaacagctgcgccacccctgcggcgcccccgtcgaatgcgtgatcgccgat
acctgcatcgccggcatggccgaagccgccgcctgcgaagagaaattcagccgcagcaac
gtgggtctgaccattaccgtgaccccctgctggtgctacggcagcgaaaccatcgacatg
gatccgctgcgtcccaaggccatctggggcttcaacggcaccgagcgccccggcgcagtc
tatctggccgccgcgctggccgcccacagccagaaagggatcccggccttctccatctat
ggccatgacgtgcaggactccggcgatgacagcatcccggccgacgtgcagcagaagctg
ctgcgctttacccgcgccgggctggcggtggccggaatcaaagggaaaagctacctgtcg
ctgggcggcgtgtcgatgggcatcgccggctccatcgtcgatcacgacttctttgagtcc
tggctgggcatgaaggtgcaggccgtcgatatgaccgagctgcgccgccgcatcgataac
caaatctatgaccaagacgagctggccctggcccttgagtgggctgatgctcacttccgc
tacggcccggatctcaacgccgagcagtatcgtcgctcgccggaggagaaccgccgcgtg
ctgcgcgaaagcctgctgatggcgatctgcatccgcgacatgatgcagggcaacccgaag
ctggccgaacggggctgggaggaggaggcgctgggctataacgccgtggccgccgggttc
caagggcagcgccactggaccgatcaataccccaacggcgacaccgccgaagcgctgctc
aacagcgcctttgactggcacggcgtacgccgtccgctggtggtggcgaccgaaaatgac
agcctcaacggcgtcgccatgctgttcggccacatgctcaccggcaccgcccagatcttt
gccgacgtccgcacctactggtcgccgcaggcggtcgagcgcgtcaccggccagaggctg
gaggggctggccgagcacggcatcatccacctgatcaactccggctccgccgcgctggac
ggcacctgccgtcagcaggacgccgaggggcacccgaccatcaagccacactggcagatc
agccagcaggaggccgacgcctgcctggccgcgacggagtggtgcccggccatccacgaa
tacttccgcggcggcggcttctcctcccgcttcctgacccgcggcggcgtccccttcacc
atgagccgcgtcaacctgatcaagggcgtcgggccggtgctgcagatcgccgaaggctgg
agcgtcgagctgccggaggagatgcacgatatcctcgacaaccgcaccaacgccacctgg
ccgaccacctggttcgtgccgcgcctgaccggcaatggcccgttcaaggatgtctactcg
gtgatggccaactggggcgccaaccacggggttctgaccatcggccacgtcggcgcggac
ctgattaccctggcctccatgctgcgcattccggtatgcatgcacaacgtcaccgatgac
gccatctaccgtccctccgcttgggccgcccacgggatggacagcgaaggtcaggactac
cgcgcctgccagaactacggcccgctgtacaagcgcgcctga

DBGET integrated database retrieval system