KEGG   Edwardsiella tarda FL6-60: ETAF_0254Help
Entry
ETAF_0254         CDS       T02091                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:etd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300698..301345
Genome map
AA seq 215 aa AA seqDB search
MERETLARAIIDTCLEMTRLGLNQGTAGNVSVRYRDGMLITPTGIPYEQLRCDQIVYVDG
EGQHEEGKLPSSEWRFHLAAYQARPDANAVVHNHAIHCTAVSILNRPIPAIHYMIAAAGG
NTIPCAPYATFGTRTLSDYVTEALKYRRATLLQHHGLIACGENLQKALWLAHEVEVLAQL
YLATLAIVDPVPVLSDEEIAVVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaacactggcgcgcgccattattgatacctgcctggagatgacgcgtctt
gggctgaatcagggcacggcaggcaacgtcagcgtgcgttaccgcgacggcatgctgatt
accccgaccggtatcccctatgagcagctgcgctgcgatcaaatcgtctatgtggatggc
gaggggcagcatgaagagggcaagctgccctccagcgaatggcgttttcatctggccgcc
tatcaggcccgccctgatgccaatgcggtggtccataatcacgcgattcactgtaccgcc
gtgtcgatcctgaaccgaccgatcccggcgatccactacatgatcgccgccgccggcggc
aacacgatcccctgtgccccctacgcgacgtttggtacccgtaccctgtcggattacgtg
actgaggcgctgaaataccgcagggcgacgctgctgcagcaccacggcctgatcgcctgt
ggagaaaacctgcagaaggcgctgtggctggcgcacgaggtcgaggtgctggcccagctg
tacctcgccaccctggcgatcgtcgatccggtgccggtgctctccgatgaggagatcgcg
gtggtgctggagaaattcaaaacctatggcctgcgtattgaagagtga

DBGET integrated database retrieval system