KEGG   Edwardsiella tarda FL6-60: ETAF_0328Help
Entry
ETAF_0328         CDS       T02091                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ETAF_0328
Enzymes [BR:etd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ETAF_0328
Transfer RNA biogenesis [BR:etd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ETAF_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395460..396200
Genome map
AA seq 246 aa AA seqDB search
MLEQICQLARDAGAAIMTVYQGDQPLALAYKGDQSPVTAADLAAHEIIKAGLLRITPAIP
LLSEEAPPAWPQRRDWQRYWLVDPLDGTKEFLQRNGEFTVNIALIEQGVPTLGVVYVPTS
GVLYCACDGKAWKEQDGVRMEIGVRNAIPPLVVISRSHGDAELTDYLQQLGEHQTMMVGS
SLKFCLVAEGIAQLYPRFGPTHIWDTAAGHAIAFAAGAQVRDWQGKTLSYIPAESLLNPG
FRVSLY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcagatttgtcagctggcgcgcgatgcgggggcggcgataatgacggtatat
cagggcgatcagccgctggcgctggcctataagggcgatcagtccccggtcacggccgcc
gatctggcggcgcatgagataatcaaggcaggattactgcgcattaccccggcgatcccg
ctgctgtcggaggaggcgccgccggcctggccgcagcggcgcgactggcagcgttattgg
ctggtcgatccgctggatggcaccaaggagtttttgcagcgcaacggtgagtttaccgtc
aatattgcgctgatcgaacagggggtacccacgctgggagtcgtctacgtgccgaccagc
ggtgtgctgtactgtgcctgcgacggtaaggcctggaaagagcaggatggggtgcgcatg
gagatcggggtacgtaacgcgatccccccgctggtggtgatcagccgttcacacggcgac
gcggagctgacggactatctgcagcagctgggcgaacaccagacgatgatggtgggatca
tcgctgaagttttgtttggtggcggaggggatcgcgcagctttatccgcgctttgggccg
acccatatctgggatacggcggccggtcatgccatcgctttcgccgcgggagctcaggtg
cgagactggcagggtaaaacgctaagctatatccccgcggaatcattgttgaatccgggg
ttccgggtatcgctgtattaa

DBGET integrated database retrieval system