KEGG   Edwardsiella tarda FL6-60: ETAF_0355Help
Entry
ETAF_0355         CDS       T02091                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:etd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
422873..423706
Genome map
AA seq 277 aa AA seqDB search
MLLRSRELTLNLNYPQVMGILNVTPDSFSDGGRHNALDAALRHAESMIVAGATIIDVGGE
STRPGAAEVSEAEELARVVPVVEALTQRFEVWVSVDTSKAAVIRACSAAGADMINDVRSL
SEPGALAAAAESGLPVCLMHMQGEPKGMQHSPHYSDVVAEVDAYLSAQIARCVAAGIARE
RLLLDPGFGFGKNLTHNYRLLANLAHFHHHGLPLLVGMSRKSMVGQLLNVPPAQRVAGSV
ACAVIAAMQGAQIIRVHDVRETVDAMRVVEATLSAKE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttaggtcacgtgaactcaccctgaatctcaactatccccaggtgatggggatc
ctgaacgtcacccccgactcgttttctgacggagggcgtcataacgcgctggatgccgcg
ctgcgacacgcggagtcgatgatcgttgccggggcgaccatcatcgatgtgggcggggag
tcgactcggccgggtgccgccgaggtgagcgaggctgaggagctggcgcgggtggtgccg
gtagtggaggcgctgacgcagcgttttgaggtctgggtgtcggtcgatacctccaaggcg
gcggtgatccgcgcctgcagcgccgccggggccgatatgattaacgacgtccgttcactg
agcgagccgggggcgctggcggcggcggcggagagcggcctgccggtctgtctgatgcat
atgcagggcgagccgaagggcatgcagcatagcccccactacagcgatgtggtggcggaa
gtggacgcttacctcagtgcgcagatcgcgcgctgcgtggccgccgggatcgcccgggag
cggctgttgctcgatcccggctttggcttcggtaagaacttgacgcataattaccgcctt
ctggctaacctggcgcactttcatcaccacggtctgccgctattggtgggaatgtcgcgt
aagtctatggtcggacagctgctgaatgtgcctcccgcgcagcgggtggcgggcagcgtc
gcctgtgccgtgatcgccgccatgcagggggcgcagattatccgggtacacgacgtacgt
gaaacggttgatgccatgcgcgtggtggaagccacgctttcagcaaaggaataa

DBGET integrated database retrieval system