KEGG   Edwardsiella tarda FL6-60: ETAF_0429Help
Entry
ETAF_0429         CDS       T02091                                 

Definition
DNA polymerase III psi subunit (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ETAF_0429
   00240 Pyrimidine metabolism
    ETAF_0429
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ETAF_0429
   03430 Mismatch repair
    ETAF_0429
   03440 Homologous recombination
    ETAF_0429
Enzymes [BR:etd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ETAF_0429
DNA replication proteins [BR:etd03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ETAF_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503838..504248
Genome map
AA seq 136 aa AA seqDB search
MTSRRDQLLQQLGITQWVLRRPALLRGEVAITLSAQTRLLIVSEAPLSPDDLLLCDILRA
LSLTAEQAVILTPEQYEMLSDRQRYLCWWLGESASSEACLRSPALGALYHNPGAKRALWQ
QICHEQHHFFPDPGGH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgcgacgcgatcaacttttacagcagctggggataacccaatgggtcctgcgt
cgcccggcgcttctgcgcggcgaggtcgccattacgctgtcggcgcagacacggctgctt
atcgtgtctgaggctcccctgtcgccggatgatctgttactgtgcgatattctacgcgcg
ctgtcgctgacggcggagcaggcggtgatcctgacgccggagcagtatgagatgctcagc
gatcgccagcgttacctgtgttggtggctgggggagtccgcctcctctgaggcttgcctc
cgctctccggcgctcggtgcgctttaccataaccccggcgccaagcgcgccctgtggcag
caaatttgtcatgagcaacatcatttcttccctgaccccggcggacactga

  All links  
No link information was found.   
DBGET integrated database retrieval system