KEGG   Edwardsiella tarda FL6-60: ETAF_0438Help
Entry
ETAF_0438         CDS       T02091                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:etd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513782..515104
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSEEEIRFFINGIRDNTISEGQIAALAMTIFFHDMAMPERVALT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGFDIFPDDSRFRSIIADVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTFALSEALAQAIVGVANGAGCRTTALLT
DMNQVLASSAGNALEVREAVQFLTGEARNPRLFEVTMALCVEMLISGKLAADQTEARNKL
QAVLDNGKAAEIFGRMVAAQSGPCDFVERYDHYLPQAVLCKPVFAEQAGIITAMDTRALG
MSVVGLGGGRRQASDSIDYSVGLTEMVRLGDSVDGQRPLAVVHARDEASWQQAAEAVRAA
VTLGERAPEPTPVVYRRITQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggctcaagaaattatccgcaaaaagcgcgacggccatgcgctgagcgaagaa
gaaattcgctttttcatcaacgggatccgggataacacgatctccgagggacagatcgcc
gcgctggcgatgacgatctttttccacgatatggccatgccggagcgcgtggcgctgacc
atggcgatgcgggactccggcaccgtgctggactggaagtccctgaatctgaacgggccg
attgtcgataagcattcgaccggtggcgtgggggacgtgacctcactgatgctggggccg
atggtcgccgcctgcggtggctatgtgccgatgatctccggtcgcggcctcgggcatacc
ggcggcacgctggataagctagaatcgatcccagggttcgacattttcccggacgacagc
cgtttccgcagcattatcgccgatgtcggcgtcgccattatcgggcagaccagctcgctg
gcgccggcggataagcgtttttatgcgacgcgcgatatcaccgcgacggtcgactctatc
ccgctgatcactgcctctattctggccaagaagctggccgaggggctggatgcgctggtg
atggatgtgaaggttggctccggcgcctttatgccgacgttcgcgctgtctgaggcgctg
gcgcaggcgatcgttggcgtggccaacggcgcaggctgccgcaccacggcgctgctgacc
gacatgaatcaggtgctggcctccagcgccggtaacgcgttggaagtgcgcgaggcggtg
cagttcctgacgggcgaggcgcgcaatccgcgtctgttcgaggtcaccatggcgctgtgc
gttgagatgctgatctccggcaaactggccgcagatcagacggaggcccgcaataagctg
caggcggtactcgacaacggtaaggcggcagagatctttggccgaatggtggcggcgcag
agcggtccgtgtgacttcgttgagcgctatgaccactatttgccacaggcagtgctgtgc
aaaccggtatttgccgaacaagctggtattatcacagcaatggacacccgtgcgctgggg
atgtccgttgtcgggctgggcggcggtcgccgtcaggccagcgatagcattgattacagc
gtagggctaaccgagatggttcgtctgggtgattcggtcgatgggcagcgcccgctggcc
gtggttcatgcccgcgatgaagcgagctggcagcaggccgccgaggcggtgcgcgccgcg
gtgacgctgggagagcgtgcgcctgagccgacgccggtggtgtatcgccgtatcacgcag
taa

DBGET integrated database retrieval system