KEGG   Edwardsiella tarda FL6-60: ETAF_0515Help
Entry
ETAF_0515         CDS       T02091                                 

Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ETAF_0515
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAF_0515
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ETAF_0515
Enzymes [BR:etd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ETAF_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
600432..601718
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHALPALARAQIDALLEQDFVTRSAHILA
AYLGDEFPFETLRDRVQAAFDFPAPVVPVSDDIAALELFHGPTLAFKDFGGRFMAQMLQQ
VAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVSPLQEKLFCTLGGNIRTL
AIEGDFDACQALVKQAFDDPTLCRELGLNSANSINISRLLAQICYYFEAVAQLPQAARNQ
LVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPRFLSSGVWQPHETVATLSNA
MDVSRPNNWPRVEELFRRREWSLGALGSGALSDAQTAAAMRELAALGYVSEPHAAIAYRA
LRDDLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQALAARAALPLLSQTLPADFSRL
RAALLDRP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatttaaaagatcacaacgagcaggttaactttgcgcaggcgctggtg
caggggctggggcgccagcagggactgttctttccccatgcgctgcccgccctggcgcgg
gcgcagatcgatgccctgctggagcaggattttgtaacccgcagcgcgcatattctggcg
gcgtatctgggggatgagttcccctttgagacgctgcgcgatcgggtgcaggccgccttc
gacttccctgcgccggtggtgccggtcagcgatgatatcgctgcgctggagctgtttcat
gggccgacgctggcattcaaggactttggcgggcgctttatggcgcagatgctgcagcag
gtcgcaggggagcggccggtgaccattctgaccgccacctccggcgataccggcgccgcg
gtcgcccatgcgttttatggtctgaaaaacgtccaggtggtgatcctctacccgcgcggc
aaggtcagtccgctgcaggagaagctgttctgtaccctgggcggcaatattcgtacgctg
gcgatcgagggcgatttcgatgcctgccaggcgctggtcaaacaggcgtttgacgatccg
acgctgtgccgtgagctggggctaaactcggctaactctatcaatatcagccggctgctg
gcgcagatctgctactactttgaggcggtagcccagctgccgcaggcggcgcgcaatcag
ctggtgatctcggtaccgagcggcaacttcggcgatctgaccgccgggctgctggcccag
tcgctggggctgccggtgaagcgttttatcgccgcgaccaatgccaatgataccgtgccg
cgtttcttatccagcggcgtctggcagccccatgagaccgtcgcgaccctctccaatgcc
atggacgtcagccgtcccaacaactggccgcgggtggaagagctgttccggcgtagagag
tggtcgctgggcgcgctgggctccggggcgctgagcgatgcgcagaccgcggcggcgatg
cgtgagctggcggcgctcgggtatgtcagcgaaccccatgctgctatcgcctatcgagcg
ctgcgtgacgatctgcagcccggcgagtatggcctgtttctgggaaccgcccatccggcc
aagttccaagagtctgttgaagcgatcctgcagcggagcatcccgctaccgcaggcgttg
gcggcgcgggctgcactgccgctgctgtcacagacgctgcccgccgacttttcccgcctg
cgggcggcactgctggatcgcccataa

DBGET integrated database retrieval system