KEGG   Edwardsiella tarda FL6-60: ETAF_0515Help
Entry
ETAF_0515         CDS       T02091                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00260  Glycine, serine and threonine metabolism
etd00750  Vitamin B6 metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01230  Biosynthesis of amino acids
Module
etd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAF_0515
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ETAF_0515
Enzymes [BR:etd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ETAF_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADM40639
UniProt: A0A0H3DN67
Position
600432..601718
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHALPALARAQIDALLEQDFVTRSAHILA
AYLGDEFPFETLRDRVQAAFDFPAPVVPVSDDIAALELFHGPTLAFKDFGGRFMAQMLQQ
VAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVSPLQEKLFCTLGGNIRTL
AIEGDFDACQALVKQAFDDPTLCRELGLNSANSINISRLLAQICYYFEAVAQLPQAARNQ
LVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPRFLSSGVWQPHETVATLSNA
MDVSRPNNWPRVEELFRRREWSLGALGSGALSDAQTAAAMRELAALGYVSEPHAAIAYRA
LRDDLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQALAARAALPLLSQTLPADFSRL
RAALLDRP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatttaaaagatcacaacgagcaggttaactttgcgcaggcgctggtg
caggggctggggcgccagcagggactgttctttccccatgcgctgcccgccctggcgcgg
gcgcagatcgatgccctgctggagcaggattttgtaacccgcagcgcgcatattctggcg
gcgtatctgggggatgagttcccctttgagacgctgcgcgatcgggtgcaggccgccttc
gacttccctgcgccggtggtgccggtcagcgatgatatcgctgcgctggagctgtttcat
gggccgacgctggcattcaaggactttggcgggcgctttatggcgcagatgctgcagcag
gtcgcaggggagcggccggtgaccattctgaccgccacctccggcgataccggcgccgcg
gtcgcccatgcgttttatggtctgaaaaacgtccaggtggtgatcctctacccgcgcggc
aaggtcagtccgctgcaggagaagctgttctgtaccctgggcggcaatattcgtacgctg
gcgatcgagggcgatttcgatgcctgccaggcgctggtcaaacaggcgtttgacgatccg
acgctgtgccgtgagctggggctaaactcggctaactctatcaatatcagccggctgctg
gcgcagatctgctactactttgaggcggtagcccagctgccgcaggcggcgcgcaatcag
ctggtgatctcggtaccgagcggcaacttcggcgatctgaccgccgggctgctggcccag
tcgctggggctgccggtgaagcgttttatcgccgcgaccaatgccaatgataccgtgccg
cgtttcttatccagcggcgtctggcagccccatgagaccgtcgcgaccctctccaatgcc
atggacgtcagccgtcccaacaactggccgcgggtggaagagctgttccggcgtagagag
tggtcgctgggcgcgctgggctccggggcgctgagcgatgcgcagaccgcggcggcgatg
cgtgagctggcggcgctcgggtatgtcagcgaaccccatgctgctatcgcctatcgagcg
ctgcgtgacgatctgcagcccggcgagtatggcctgtttctgggaaccgcccatccggcc
aagttccaagagtctgttgaagcgatcctgcagcggagcatcccgctaccgcaggcgttg
gcggcgcgggctgcactgccgctgctgtcacagacgctgcccgccgacttttcccgcctg
cgggcggcactgctggatcgcccataa

DBGET integrated database retrieval system