KEGG   Edwardsiella tarda FL6-60: ETAF_0543Help
Entry
ETAF_0543         CDS       T02091                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETAF_0543
   00670 One carbon pool by folate
    ETAF_0543
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ETAF_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635288..635770
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALSADRVIGLDNAMPWHLPADLAWFKRNTLAKPVIMGRKTYESIGRPLPGRHN
IVISRRAGCDDRVTWVTTPQAALEAAAEAQEVMIIGGGSIYSQFLPQASRLYLTHVDADV
AGDTYFPDYAPDEWQTCFSEFHDADSDNSHAYCFEILDRR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgccgcactgagcgcggatcgtgtgatcggtttagacaatgcg
atgccgtggcatttgccggccgatcttgcgtggtttaagcgtaatactctggcaaaacca
gtgatcatggggcgtaaaacctatgagtccatcgggcgtccgctgccggggcgtcataac
atcgtgatcagccgccgggcgggctgcgacgatcgcgtcacctgggtgacgacgcctcag
gccgcgctggaggccgcagcggaggcgcaagaggtgatgatcatcggcggaggcagcatt
tacagccagtttttgccgcaggcgagccgactgtatctgacccatgtggacgctgacgtc
gccggggacacctattttcccgactatgcgccggatgagtggcagacgtgcttcagcgag
tttcatgacgccgatagcgacaattcacacgcctactgttttgagatcctggatcgccgt
taa

DBGET integrated database retrieval system