KEGG   Edwardsiella tarda FL6-60: ETAF_0543Help
Entry
ETAF_0543         CDS       T02091                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:etd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:etd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635288..635770
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALSADRVIGLDNAMPWHLPADLAWFKRNTLAKPVIMGRKTYESIGRPLPGRHN
IVISRRAGCDDRVTWVTTPQAALEAAAEAQEVMIIGGGSIYSQFLPQASRLYLTHVDADV
AGDTYFPDYAPDEWQTCFSEFHDADSDNSHAYCFEILDRR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgccgcactgagcgcggatcgtgtgatcggtttagacaatgcg
atgccgtggcatttgccggccgatcttgcgtggtttaagcgtaatactctggcaaaacca
gtgatcatggggcgtaaaacctatgagtccatcgggcgtccgctgccggggcgtcataac
atcgtgatcagccgccgggcgggctgcgacgatcgcgtcacctgggtgacgacgcctcag
gccgcgctggaggccgcagcggaggcgcaagaggtgatgatcatcggcggaggcagcatt
tacagccagtttttgccgcaggcgagccgactgtatctgacccatgtggacgctgacgtc
gccggggacacctattttcccgactatgcgccggatgagtggcagacgtgcttcagcgag
tttcatgacgccgatagcgacaattcacacgcctactgttttgagatcctggatcgccgt
taa

DBGET integrated database retrieval system