KEGG   Edwardsiella tarda FL6-60: ETAF_0577Help
Entry
ETAF_0577         CDS       T02091                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ETAF_0577
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETAF_0577
Enzymes [BR:etd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ETAF_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681863..683272
Genome map
AA seq 469 aa AA seqDB search
MDSRVAAAGDLFVAVVGHAADGRRFIPQAIAQGVAAVIAEAEGEAEDGSVRELHGVPVVY
LSHLNERLSALAGRFYGQPGADLRLVGVTGTNGKTTTTQLLAQWAQLLGETGAVMGTVGN
GLLGHVYPSENTTGSAVDVQHMLRTLADDGATLVAMEVSSHGLVQNRVLALPFAASAFTN
LSRDHLDYHGDMEHYAQAKWRLFSTHHSGEKIINADDETGRRWLDKLPDAVAVTVSGALP
AGWAGRWLAARSVAYHDGGATIAFDSCWGAGTLNSRLMGEFNVSNLLVALATLLALGYPL
AALCAASGQLQPVCGRMEVFQAPGKPTVVVDYAHTPDALEKALLAARLHCQGLLWCLFGC
GGDRDTGKRPLMGAIAEQYADRVVVTDDNPRSEEPRAIINEILSGMLDPGLAMAIPGRAE
AVTAAVMQAAPQDVILVAGKGHEDYQLVGNRRLDYSDRVTVARLLGVVA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
ttggacagccgcgtggcggctgcaggcgatctgttcgtggccgtcgttggccacgcggcg
gacggacgccgttttattccgcaggccattgcgcagggcgtcgccgccgttatcgctgag
gccgagggcgaggccgaggacggcagcgtacgcgagctgcacggcgtgccggtcgtgtat
ctcagccatctcaacgagcgtctttccgcgctggcggggcgtttctacggtcagccgggc
gccgatctgcgtctggtgggcgtgaccgggaccaacggtaaaacgacgaccacccagctg
ctggcgcagtgggctcagctgctgggcgaaaccggcgccgtgatgggcaccgtcggcaac
ggcctgctggggcatgtctatcccagcgaaaacaccaccggctcggccgtcgacgtacag
cacatgctgcgcacgctggccgatgacggcgcaaccctggtcgcgatggaggtctcttcg
cacggtctggtgcaaaatcgcgtgctggcgctgccgtttgccgcgtcggcctttaccaac
ctgagccgcgatcacctggattatcatggtgatatggagcactacgcccaggcgaaatgg
cgcctgttctcgacccatcacagcggtgagaagatcatcaacgctgacgatgaaacgggg
cgacgctggctggataagctaccggatgcggtggcggtgaccgtcagcggcgcgctgccc
gcaggttgggcggggcgctggttggccgcgcgctctgtggcgtatcacgacggcggcgcg
acgatcgcgttcgactcctgctggggggcgggcacgctgaacagtcgcctaatgggcgaa
tttaacgtcagtaacctgttagtggcgctggcgacgctgctggcgctcggctatccgttg
gcggcgctgtgcgccgcgtctggccagctgcagccggtctgtgggcgaatggaggtcttc
caggcgcccggtaagcctacggtggtggtcgactatgcccataccccagacgcgctggag
aaagcgctgctggctgcgcgtctgcactgccaggggctgctgtggtgcctgttcggctgc
ggcggggatcgcgacacgggcaaacgtccgctgatgggggcgattgccgaacagtatgcc
gatcgggtggtggtgacagacgataacccgcgcagtgaagagccgcgggcgatcatcaac
gaaattctcagcggtatgctggatccgggactggcgatggctatccccgggcgtgccgag
gcggtgaccgccgccgtgatgcaggcggcgccgcaggatgtgatcctggtggccggcaag
gggcatgaggattatcagctggtcggcaaccgccgtctggactactccgatcgggtgacg
gtagcccgtctgctgggggtggtagcatga

DBGET integrated database retrieval system