KEGG   Edwardsiella tarda FL6-60: ETAF_0605Help
Entry
ETAF_0605         CDS       T02091                                 

Definition
Dihydrolipoamide acetyltransferase component (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAF_0605
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_0605
   00020 Citrate cycle (TCA cycle)
    ETAF_0605
   00620 Pyruvate metabolism
    ETAF_0605
Enzymes [BR:etd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ETAF_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
713968..715842
Genome map
AA seq 624 aa AA seqDB search
MAIAINVPDIGADEVEVTEILVKVGDRVDAEQSLITVEGDKASMEVPSPQAGVISAIKVA
VGDKVTTGSLIMEFEAADAAAAQPAAQVQPAAAPAQAAAAQVRDVQVPDIGGDEVEVTEI
LVKVGDSVSAEQSLITVEGDKASMEVPAPFAGVVQSIAIATGDKVKTGSPIMTFSIAGAA
SPAPTAAAVAPAAPVAQAAASQPVSVPDIGGDEVEVTEILVKVGDSVSAEQSLITVEGDK
ASMEVPAPFAGVVSAIAVSVGDKVKTGSPIMTFSVAGSAPAPSASAPATAAPVSAPATSA
AAALAAVQTTSEFTENAAYVHATPVIRRLAREFGVNLAKVKGSGRKGRILREDVQTYVKE
LIKRAETAPAAATGGSLPGLLPWPKVDFSKFGEVEEVELGRIQKISGANLHRNWVMIPHV
TQFDETDITEVEAFRKQQNVESEKRKLGVKITPLVFIIKAAAKALEAMPRFNSSLSEDAQ
RLTLKKYINIGVAVDTPNGLVVPVLRDVNKKGIIELSRDLAEISAKARAGKLTAADMQGG
CFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKEFAPRLMLPLALSYDHRVI
DGADGARFISFINSVMSDIRRLVM
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgcaatcaatgtaccggacatcggtgcggatgaagtagaagtcactgaaatt
ctggtgaaagtcggtgaccgggttgatgcggagcagtctctgattaccgttgaaggcgac
aaggcttcaatggaggtcccctcgccgcaggccggcgttatcagcgctatcaaggttgcg
gtgggcgataaggtcacgaccggctctctgatcatggagttcgaggcggccgatgccgct
gcggcccagccggcggcccaagtgcaaccggcagcggctccggctcaggccgccgctgca
caggtgcgtgacgttcaggtgccggatatcggtggcgatgaagtggaagtcaccgagatc
ctggtgaaggtcggcgacagcgttagcgctgaacagtcgctgatcaccgtcgaaggcgat
aaagcctcgatggaggtgccggcgccgttcgccggggtggttcaatccatcgctatcgcc
accggagacaaggtgaagaccggttcgccgatcatgacctttagcatcgcgggcgccgcc
tctccggccccgacagcggcggccgtcgcgcctgccgcgccggtggcccaggctgccgcc
agccagccggtcagcgtgccggatatcggcggtgatgaggttgaagtcaccgaaattctg
gtcaaggtgggcgacagcgtcagcgctgaacagtcgctgatcaccgtcgaaggcgataag
gcttcgatggaggtgccggcgccgtttgccggggttgtcagcgccatcgcagtcagcgtg
ggcgataaggtgaaaaccggctcgccgatcatgaccttcagcgtggcgggcagcgcgcct
gcgccgtcggcatctgcgccagcgaccgcggcgccggtaagtgcgccagccacctccgcg
gctgcagcgcttgcggcggtacagacgacgagcgagttcaccgaaaacgccgcctatgtg
catgcgacgccggtgatccgccgtctggcgcgtgagtttggcgttaacctggccaaggta
aaaggcagcgggcgtaagggccgcattctgcgcgaagacgtacagacctatgtcaaagag
ctgattaagcgcgctgaaaccgcgccagcggcggcaaccgggggctctttgccgggtctg
ctgccgtggccgaaggtggacttcagcaagttcggcgaggtggaagaggttgagctgggg
cgtattcagaagatctccggcgccaacctgcaccgcaactgggtgatgatcccgcatgtc
acccagtttgatgagaccgatatcaccgaggtggaagcgttccgcaaacagcagaacgtg
gagtccgagaagcgcaagctgggggttaaaattaccccgctggtgtttatcatcaaggcg
gcggccaaggcgttagaggcgatgccgcgctttaacagctccctgtctgaggatgcccag
cgtctgacgctgaagaagtacatcaacatcggcgtcgcggtcgatacgccgaacggcctg
gtggttccggtgctgcgcgacgtcaacaagaagggcatcatcgagctgtcgcgcgatctg
gcggagatctcagccaaggcgcgcgccggcaagctgaccgccgcggacatgcagggcggc
tgcttcactatctccagcctgggcggtatcggcggcacggcgtttacgccgatcgtcaac
gcaccggaggtggcgatcctgggggtatccaagtcgtcgatgaagccggtatggaatggg
aaagagtttgcgccgcgcctgatgctgccgctggcgctctcctatgaccatcgggtgatc
gacggtgccgacggcgcccgctttatcagcttcatcaacagcgtgatgtccgacatccgc
cgcctggtgatgtaa

DBGET integrated database retrieval system