KEGG   Edwardsiella tarda FL6-60: ETAF_0605Help
Entry
ETAF_0605         CDS       T02091                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00010  Glycolysis / Gluconeogenesis
etd00020  Citrate cycle (TCA cycle)
etd00620  Pyruvate metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01130  Biosynthesis of antibiotics
etd01200  Carbon metabolism
Module
etd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_0605
   00020 Citrate cycle (TCA cycle)
    ETAF_0605
   00620 Pyruvate metabolism
    ETAF_0605
Enzymes [BR:etd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ETAF_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADM40729
UniProt: A0A0H3DNE5
Position
713968..715842
Genome map
AA seq 624 aa AA seqDB search
MAIAINVPDIGADEVEVTEILVKVGDRVDAEQSLITVEGDKASMEVPSPQAGVISAIKVA
VGDKVTTGSLIMEFEAADAAAAQPAAQVQPAAAPAQAAAAQVRDVQVPDIGGDEVEVTEI
LVKVGDSVSAEQSLITVEGDKASMEVPAPFAGVVQSIAIATGDKVKTGSPIMTFSIAGAA
SPAPTAAAVAPAAPVAQAAASQPVSVPDIGGDEVEVTEILVKVGDSVSAEQSLITVEGDK
ASMEVPAPFAGVVSAIAVSVGDKVKTGSPIMTFSVAGSAPAPSASAPATAAPVSAPATSA
AAALAAVQTTSEFTENAAYVHATPVIRRLAREFGVNLAKVKGSGRKGRILREDVQTYVKE
LIKRAETAPAAATGGSLPGLLPWPKVDFSKFGEVEEVELGRIQKISGANLHRNWVMIPHV
TQFDETDITEVEAFRKQQNVESEKRKLGVKITPLVFIIKAAAKALEAMPRFNSSLSEDAQ
RLTLKKYINIGVAVDTPNGLVVPVLRDVNKKGIIELSRDLAEISAKARAGKLTAADMQGG
CFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKEFAPRLMLPLALSYDHRVI
DGADGARFISFINSVMSDIRRLVM
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgcaatcaatgtaccggacatcggtgcggatgaagtagaagtcactgaaatt
ctggtgaaagtcggtgaccgggttgatgcggagcagtctctgattaccgttgaaggcgac
aaggcttcaatggaggtcccctcgccgcaggccggcgttatcagcgctatcaaggttgcg
gtgggcgataaggtcacgaccggctctctgatcatggagttcgaggcggccgatgccgct
gcggcccagccggcggcccaagtgcaaccggcagcggctccggctcaggccgccgctgca
caggtgcgtgacgttcaggtgccggatatcggtggcgatgaagtggaagtcaccgagatc
ctggtgaaggtcggcgacagcgttagcgctgaacagtcgctgatcaccgtcgaaggcgat
aaagcctcgatggaggtgccggcgccgttcgccggggtggttcaatccatcgctatcgcc
accggagacaaggtgaagaccggttcgccgatcatgacctttagcatcgcgggcgccgcc
tctccggccccgacagcggcggccgtcgcgcctgccgcgccggtggcccaggctgccgcc
agccagccggtcagcgtgccggatatcggcggtgatgaggttgaagtcaccgaaattctg
gtcaaggtgggcgacagcgtcagcgctgaacagtcgctgatcaccgtcgaaggcgataag
gcttcgatggaggtgccggcgccgtttgccggggttgtcagcgccatcgcagtcagcgtg
ggcgataaggtgaaaaccggctcgccgatcatgaccttcagcgtggcgggcagcgcgcct
gcgccgtcggcatctgcgccagcgaccgcggcgccggtaagtgcgccagccacctccgcg
gctgcagcgcttgcggcggtacagacgacgagcgagttcaccgaaaacgccgcctatgtg
catgcgacgccggtgatccgccgtctggcgcgtgagtttggcgttaacctggccaaggta
aaaggcagcgggcgtaagggccgcattctgcgcgaagacgtacagacctatgtcaaagag
ctgattaagcgcgctgaaaccgcgccagcggcggcaaccgggggctctttgccgggtctg
ctgccgtggccgaaggtggacttcagcaagttcggcgaggtggaagaggttgagctgggg
cgtattcagaagatctccggcgccaacctgcaccgcaactgggtgatgatcccgcatgtc
acccagtttgatgagaccgatatcaccgaggtggaagcgttccgcaaacagcagaacgtg
gagtccgagaagcgcaagctgggggttaaaattaccccgctggtgtttatcatcaaggcg
gcggccaaggcgttagaggcgatgccgcgctttaacagctccctgtctgaggatgcccag
cgtctgacgctgaagaagtacatcaacatcggcgtcgcggtcgatacgccgaacggcctg
gtggttccggtgctgcgcgacgtcaacaagaagggcatcatcgagctgtcgcgcgatctg
gcggagatctcagccaaggcgcgcgccggcaagctgaccgccgcggacatgcagggcggc
tgcttcactatctccagcctgggcggtatcggcggcacggcgtttacgccgatcgtcaac
gcaccggaggtggcgatcctgggggtatccaagtcgtcgatgaagccggtatggaatggg
aaagagtttgcgccgcgcctgatgctgccgctggcgctctcctatgaccatcgggtgatc
gacggtgccgacggcgcccgctttatcagcttcatcaacagcgtgatgtccgacatccgc
cgcctggtgatgtaa

DBGET integrated database retrieval system