KEGG   Edwardsiella tarda FL6-60: ETAF_0683Help
Entry
ETAF_0683         CDS       T02091                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:etd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797463..798662
Genome map
AA seq 399 aa AA seqDB search
MKTLTILGSTGSIGTSTLAVVRANPGAFRVVALVAGKNVDVMLQQCREFSPRYVCMADEG
AAAALRQRLFECGLGAIAVMSGEHAACELAALDEVDQVMAAIVGAAGLLPTLAAIRANKR
VLLANKEALVTCGRLFMEALSHSQAQLLPIDSEHNAIFQSLPTAVQQQLGFASLREHGVT
RIVLTGSGGPLRQLPLADFDAVTPAQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLF
NASAEEMEVIVHPQSVIHSMVRYRDGSVIAQLGNPDMCTPIAHAMAYPDRAPSGVAPLDF
CRMGSLSFEAPDMARYPCLQLAIEAFAEGQAATTALNAANEIAVAAFLDGRLRFTDIARL
NRGVVEQLRCAEPDCVEAVLAIDCAARQAAQTLSARFSR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctgaccattttaggttcaaccggctccatcggcaccagtacgctggcggtg
gtgcgggccaatcccggcgcgttccgcgtggtagcactggtggcaggcaagaacgttgat
gtcatgctgcagcagtgccgtgaattttccccccgctatgtctgtatggccgatgaaggt
gccgccgccgcgctgcgccagcgcctgttcgagtgcggccttggcgcgattgccgtgatg
agcggcgagcacgccgcctgcgagctcgccgccctggatgaggtcgaccaggtgatggcg
gcgatcgtcggcgccgcgggcctgctgccgacgctggcggcgattcgggctaacaagcgg
gtgctgctggccaacaaagaggccctagtgacctgtggacgtctgtttatggaggcgctc
tcccacagccaggcgcagctgctgcctatcgacagtgaacacaacgccatttttcagagc
ctgccgacggcggtacagcagcagctgggctttgccagcctgcgtgagcacggggtgacc
cgtatcgtactgaccggctccggcgggccgctgcgtcagctgccgttggcggattttgat
gctgtcacgccggcgcaggcctgcgcgcatcccaactggtctatggggcgtaagatctcc
gtcgactccgccaccatgatgaataaagggctggagtatattgaggcgcgctggctgttc
aatgcctcggcggaggagatggaggtgatcgttcacccgcagtcggtgatccactccatg
gtgcgctaccgggacggcagcgtgattgcccagctgggtaatcctgacatgtgtacgccg
atcgcccacgccatggcctatcccgaccgcgcgccgagcggcgttgcgccgctggatttc
tgccgaatgggctcgctgagctttgaggcgccggatatggcgcgctacccctgtctgcag
ctggctatcgaggcgtttgccgaggggcaggcggcgacgacggcgctgaatgcggcgaat
gaaattgcggttgccgcctttctcgatgggcgtctacgctttactgacatcgcccggctg
aaccgcggcgtggtggagcagctgcgctgcgctgagccggactgcgttgaggcggtgctg
gcgattgattgcgccgctcgccaggcggcccagacgctgagcgcgcgtttttcccgctaa

DBGET integrated database retrieval system