KEGG   Edwardsiella tarda FL6-60: ETAF_0738Help
Entry
ETAF_0738         CDS       T02091                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:etd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:etd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
860518..861624
Genome map
AA seq 368 aa AA seqDB search
MTSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREH
LGYPDLPATIASKQLLAAVGQSSLIQLWQQLFAIYGIHIGQVLLTRADMEDRERFLNARD
TLHALMDNRIIPVINENDAVATAEIKVGDNDNLSALAAILAGANKLLLLTDQAGLFTADP
RHNPAAELIREVTGIDDALRGIAGDSVSGLGTGGMTTKLQAADVACRAGIEVVIAAGSRP
GVIGEVIDGVSVGTRFHPLQTPLENRKRWIFGAPPAGEIVVDDGALEAIVTRGSSLLPKG
IREVSGDFSRGEVVRIRTLDGRDLAHGVSRYNSDALRMIAGHHSLQISAILGYEYGPVAV
HRDDMIVS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtggcagtcagaccctggtggtaaaactgggcaccagcgtgttgaccggcggc
tcccgccgcctcaaccgcgcccatatcgtagaattggtccgtcagtgtgcccagcagcac
gccgcgggacaccgtattgtgatagtgacctccggggcgatcgccgccgggcgcgagcac
ttgggctacccggatctgccggcgaccatcgcttctaagcagctgctggcggcggtgggg
cagagtagcctgatccagctgtggcagcagctgttcgccatctacggcatccatattggc
caggtgctgctgacccgtgccgatatggaggatcgtgaacgctttcttaacgcccgcgat
accctgcacgccctgatggacaaccgtatcattccggtgatcaacgaaaacgacgcggtc
gccacggcggagatcaaggtgggcgacaacgacaatctgtcggcgctggcggcgatcctg
gccggggccaacaaactgctgctgctgaccgatcaggccgggctatttaccgccgatccg
cgccataacccggcggcagagctgatccgcgaagtgaccgggatcgatgatgcgctgcgc
ggcatcgccggcgacagcgtctctgggctgggcaccggcggcatgaccaccaagctgcag
gccgccgacgtggcctgccgcgccggtatcgaggtggttatcgccgcgggcagtcgcccc
ggcgtgatcggcgaggttatcgacggcgtctccgtcggcacccgctttcatcccctgcag
acgccgctggaaaaccgcaaacgctggatctttggcgccccgccggccggtgaaatcgtg
gtggacgacggcgcgctggaggcgatcgtcacccgcggcagctcgctgctgcccaagggg
atccgcgaagtgagcggtgacttttctcgcggtgaggtggtgcgcatccgcacgctggac
gggcgcgatctggcgcacggcgtctcccgctacaacagcgatgcgctgcgcatgattgcc
ggccaccattcgctgcaaatcagtgcgatcctcggctatgaatatggcccggtagccgta
catcgtgacgatatgatcgtcagctaa

DBGET integrated database retrieval system