KEGG   Edwardsiella tarda FL6-60: ETAF_0953Help
Entry
ETAF_0953         CDS       T02091                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:etd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1106140..1106745
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCRDC
RTFTEQEVCTICTNARRRENGQICVVESPADIHAIEQTGQYSGRYFVLMGHLSPLDGIGP
QDIGLDRLEARLGQETLSEVILATNPTVEGEATANYIAEMCAAHGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPVTR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagcccgcttcttgaatccctgatggaggcgctgcgctgtttgcccggcgtc
ggccccaagtcggcccagcgcatggcgtttcacctgctgcagcgcgatcgcagcggggga
atgcgcctggcgcaggcgctgacgcgcgcgatgtcggagatcggccactgtcgagactgt
cgcaccttcaccgagcaggaggtctgtactatctgcaccaacgcgcgtcggcgtgagaat
gggcagatctgcgtggtggagagcccggcggatattcatgccattgagcagactggacag
tactccgggcgctatttcgtgctgatggggcacctctctccgctggacggcataggtcca
caggatattggtctggacaggctggaggcgcggctgggccaagagacgctcagcgaagtg
atcctcgccaccaacccgacggtcgagggcgaggcgaccgccaactacatcgcggagatg
tgtgcggcgcacggcgtgctggccagccgtatcgcccacggcgtgccggtggggggcgag
ctggagatggtcgatggcaccaccctgtctcactcgttggccgggcgtcacccggtgacg
cgctga

DBGET integrated database retrieval system