KEGG   Edwardsiella tarda FL6-60: ETAF_1078Help
Entry
ETAF_1078         CDS       T02091                                 

Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETAF_1078
Enzymes [BR:etd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ETAF_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1249512..1250174
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAALVHEALLARGLETPLRGEPLARDTRKAQIEAHMTEVMRLLNLDLSDDSLAE
TPSRIAKMYVDEIFSGLDYANFPKITIIENKMHVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKEGVIGLSKINRIVRFFAQRPQVQERLTQQILVALQTLLGTKNVAVSIDAVHYC
VKARGVRDATSATTTTSLGGLFKTSQNTRQEFLRAVRHHV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgcactggtgcacgaggcgctgctggcgcgtgggctg
gaaaccccgctgcgcggtgagccgctggcgcgcgatacgcgtaaggcacagattgaggcg
cacatgaccgaagtcatgagactgttgaatctggatctgtcggatgacagcctggcggag
acgccgtcgcggatcgccaaaatgtacgtggacgaaattttttccggactggattacgct
aacttccctaaaatcaccattattgaaaataaaatgcatgtcgatgagatggtgacggtg
cgcgatattacgctgaccagcacctgcgaacaccatttcgtcaccatcgacggtaaggcg
acggtcgcctatatcccgaaagagggggtaattgggctgtccaagatcaaccggattgtc
cgctttttcgcccagcgtccgcaggtgcaggagcgtttgacccagcaaattctggtggcg
ctgcagacgctgttggggaccaagaacgtcgccgtctccatcgatgcggtgcactactgc
gtcaaggcccgcggcgtacgcgatgcgaccagcgcgaccaccaccacctcgcttggcggg
ctgtttaaaaccagtcaaaatacccggcaggagtttctgcgcgcggtgcgccaccacgtc
tag

DBGET integrated database retrieval system