KEGG   Edwardsiella tarda FL6-60: ETAF_1299Help
Entry
ETAF_1299         CDS       T02091                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00900  Terpenoid backbone biosynthesis
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01130  Biosynthesis of antibiotics
Module
etd_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETAF_1299
Enzymes [BR:etd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ETAF_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADM41411
UniProt: A0A0H3DPX4
Position
complement(1506324..1507205)
Genome map
AA seq 293 aa AA seqDB search
MIAALTHWPAPAKLNLFLYITGRRADGYHLLQTLFQFVDYGDTLSIQARSDGQLRLLTPV
AGVADEDNLIIRAARALRTALPPAFAGCGADIALQKSLPMGGGLGGGSSDAATTLIALNT
LWQAGLSDARLAEIGLTLGADVPVFVNGVAAFAQGVGELLQPAHPEEKWYFVAHPGVSIS
TPAIFADPALKRDSPVRTLAELLATPYSNDCEPIARKRFREVEQALSWLLEYAPSRLTGT
GACVFAEFDTEQAARQVLSIAPEWMQGFVARGVNTSPLHRVRSELLASMHVTG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgctgacccactggccggcgccggccaagctaaacctgtttctttacatc
accgggcgccgggccgatggctaccatctgctgcagaccctattccagtttgtggactac
ggcgacacgctcagtattcaggcgcgtagcgatggccagctgcgtctgctgacgccggtg
gcgggagtggcggatgaagacaacctgatcatccgcgcggcgcgagcgctgcgcaccgcg
ctgccgcccgcctttgccggatgcggcgccgacattgcgctgcaaaagagcctgcctatg
gggggcgggctcggcggcggctcgtcggatgcggccaccaccctgatcgcgctgaacacc
ctgtggcaggccgggttaagcgacgcacgtctggctgagattggattgaccctgggcgca
gatgtaccggtttttgttaatggcgttgccgcctttgcgcagggtgttggagaattgtta
caacccgcacatcctgaagaaaaatggtactttgttgcacacccgggcgtcagcatttcc
acgccggcgatcttcgccgatcctgcactgaaaagagactctccggtaagaactttggct
gaactgttggcaacaccgtacagtaatgattgcgagccaatagcaagaaaacgttttcgt
gaggttgaacaggcgctttcgtggctgctagaatacgcgccgtcgcgtctgacagggact
ggcgcttgcgtgtttgcggaattcgacaccgagcaggcggcccgtcaggtgctcagcatt
gcccccgagtggatgcagggattcgtggcgcgtggcgtcaatacgtcgccgttgcaccgt
gtccgctccgagctgctggcctctatgcacgtaactggttaa

DBGET integrated database retrieval system