KEGG   Edwardsiella tarda FL6-60: ETAF_1380Help
Entry
ETAF_1380         CDS       T02091                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ETAF_1380
Enzymes [BR:etd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ETAF_1380
    3.5.1.-  
     ETAF_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1591739..1592374)
Genome map
AA seq 211 aa AA seqDB search
MSAALLLIDLQNDFCPQGALAVPQGDEVIPVALQAVAMARRDGIPVIATQDWHPAEHGSF
ASRSGGQLGEVGELNGLPQVWWPDHCVQNTIGAAFHPALRDTAFDFVVHKGTDAAVDSYS
AFFDNGRRCATALDAWLRQHGITRLWLLGLATDYCVKFSVLDALRLGYQVNIIRDGCRGV
DLTPGDSERALAEMVRAGASLTPLTTLSHLR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgcacttttgctgatcgatctacagaatgatttttgccctcagggcgcgctg
gcggttccccagggcgatgaggtcatccccgtcgccctgcaggcggtcgccatggcgcgt
cgggacggcatcccggtgatcgcgacccaggattggcatccggcggagcacggcagcttc
gccagccgcagcggcgggcagctgggcgaggtcggcgagctcaatggcctgccccaggtc
tggtggcctgaccactgcgtgcaaaacaccatcggcgccgcgtttcacccggccctgcgc
gataccgccttcgattttgtggtgcataagggaactgacgccgcagtggatagctacagc
gcctttttcgacaacggtcggcgctgcgccaccgcgctggatgcctggctgcgccagcac
ggcatcacccgcctgtggctgctgggtctggcgacggattactgcgtgaagttttcggtg
ctggacgccctgcgcctgggctatcaggtcaatatcattcgcgacggctgccgcggcgtg
gatctcacgcccggcgatagcgaacgcgcgctggccgaaatggtccgcgccggggctagc
ctaaccccgctcaccacgctcagccacctgcgctga

DBGET integrated database retrieval system