KEGG   Edwardsiella tarda FL6-60: ETAF_1394Help
Entry
ETAF_1394         CDS       T02091                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00040  Pentose and glucuronate interconversions
etd00052  Galactose metabolism
etd00500  Starch and sucrose metabolism
etd00520  Amino sugar and nucleotide sugar metabolism
etd01100  Metabolic pathways
etd01130  Biosynthesis of antibiotics
Module
etd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETAF_1394
   00052 Galactose metabolism
    ETAF_1394
   00500 Starch and sucrose metabolism
    ETAF_1394
   00520 Amino sugar and nucleotide sugar metabolism
    ETAF_1394
Enzymes [BR:etd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETAF_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADM41506
UniProt: A0A0H3DQ69
Position
1606380..1607279
Genome map
AA seq 299 aa AA seqDB search
MRKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILVTHSS
KNSIENHFDTSFELEAILEKRVKRQLLAEVQAICPKHVTIMQVRQGLAKGLGHAILCAHP
LVGDEPFAVILPDVILDEYSADLSSDNLSEMLRRYESTGASQIMVEPVPMADVSNYGVVD
CSGAQLAAGESIAIRAVVEKPPRDKAPSNLSIVGRYVLSPDIWPLLSKTPPGAGEEIQLT
DAIAMLLKNETVEAYHLKGRSHDCGNKLGYMQAFVEYGLRHPALGKDFAAWIKGLNLSK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaagtaaaaaaagccgttatcccggtggccggattgggaacgcgtatgctgcca
gcaacgaaagctattcctaaagaaatgttgccgctggtagataaaccgctgatccagtac
gtggttaatgagtgtattgccgccggtattaatgagatcattttagtcacgcattcatcg
aagaactccatcgagaaccacttcgataccagctttgagctggaggcgatccttgagaag
cgcgttaagcgtcagctgctggccgaagtccaggccatttgtcctaagcacgtgaccatt
atgcaggtgcgtcagggactggctaaaggtttaggtcatgccattctgtgcgcacatccg
ctggtcggcgatgagccttttgccgtgatattgcctgacgttattctggatgaatacagc
gcagatttaagcagcgataacctgagtgagatgctgcgtcgctatgagtccaccggcgcc
agccagattatggttgagccggtgccgatggccgatgtttctaattatggcgtggtggat
tgcagcggtgcgcaattggctgcgggggaaagcattgctattcgcgccgtggttgaaaag
ccgccgcgcgataaggcgccgtctaacctgtctatcgttggccgctatgttctctctccg
gacatttggccgttgctgtctaaaaccccgccgggagccggtgaggaaattcagctgacg
gatgccattgccatgctgcttaagaatgaaaccgttgaggcttaccacctgaaagggcgt
agccatgactgtggaaataagctgggctatatgcaggcgtttgtcgagtatgggctacgt
catcctgcgctgggcaaagattttgcagcctggatcaaagggctgaatttaagcaagtaa

DBGET integrated database retrieval system