KEGG   Edwardsiella tarda FL6-60: ETAF_1398Help
Entry
ETAF_1398         CDS       T02091                                 

Definition
Alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ETAF_1398
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_1398
   00620 Pyruvate metabolism
    ETAF_1398
   00650 Butanoate metabolism
    ETAF_1398
  Lipid metabolism
   00071 Fatty acid degradation
    ETAF_1398
  Amino acid metabolism
   00350 Tyrosine metabolism
    ETAF_1398
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ETAF_1398
   00626 Naphthalene degradation
    ETAF_1398
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ETAF_1398
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ETAF_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1609519..1612191)
Genome map
AA seq 890 aa AA seqDB search
MAVTNTAELDALVARVKKAQREFANFSQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPTGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKQATNKAADIVLQAAIAAGAPKDIIGWIDEPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDAVYDKVRERFATHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AEKIAEMAGISVPAGTKILIGEVSVVDDSEPFAHEKLSPTLAMYRAKNFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQGARVNYFGEKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGALPIALEEVATDGAK
RAFIVTDRFLFNNGYADQVTNVLKAHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYAEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLAWLESIKAELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTYYGREFVEHAQEESKTVAAPKAEKKAKKA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaacactgctgaactcgatgcgctggtcgcccgtgtcaaaaaagcccaa
cgcgagtttgccaacttctctcaggaacaggtagacaaaatcttccgcgccgccgctctg
gccgctgccgatgcccgtattccgctggctaaaatggccgtcgctgaatccggcatgggt
atcgtggaagataaggtgatcaaaaaccacttcgcctccgaatatatctacaacgcctat
aaagatgaaaagacctgcggcatcctgtccgaagacgataccttcggcaccatcaccatc
gccgagccgaccggcctgatctgtggcatcgtaccgaccaccaacccgacctctaccgcg
atcttcaaggcgctgatcagcctgaagacccgcaacggcatcatcttctccccgcatccg
cgcgccaagcaggcgaccaacaaagccgccgatatcgtgctgcaggctgccatcgccgcc
ggcgcaccgaaagacatcatcggctggatcgatgagccgtccgtcgagctgtccaacgcg
ctgatgcaccatccggacatcaacctgatcctggccaccggtggcccgggcatggttaaa
gcggcctatagctccggcaaaccggccatcggcgttggcgccggcaacaccccggtcgtg
atcgacgaaaccgcggatatcaagcgcgccgtcgcctctatcctgatgtccaaaaccttc
gataacggcgttatctgtgcttccgagcagtctgttatcgtcgttgacgccgtctacgat
aaggttcgcgagcgtttcgctacccacggcggctacctgctgcaggggaaagagttgaaa
gccgttcaggatatcatcctgaagaatggcgcgctgaacgccgccatcgtaggccagccg
gcagagaagatcgccgaaatggccggcatcagcgtaccggcagggaccaagatcctgatc
ggcgaagtcagcgtcgttgacgactccgagccgttcgcccacgaaaaactgtctccgacc
ctggccatgtaccgcgccaaaaacttcgaagacgccgtcgagaaagccgagaaactggtt
gccatgggcggtatcggtcatacctcctgcctgtacaccgaccaagataaccagggtgcg
cgcgtaaactacttcggcgagaagatgaagaccgcccgtatcctgatcaataccccggcc
tctcaagggggtatcggtgacctgtacaacttcaagctggcgccttccctgacgctgggc
tgcggctcctggggcggtaactccatctctgaaaacgtgggtccgaagcacctgatcaac
aagaaaacggtagcgaagcgagcagaaaacatgttgtggcataaacttccgaagtctatc
tacttccgccgcggcgccctgccgatcgcgctggaagaagtggcaaccgacggtgccaag
cgcgcctttatcgtcaccgaccgtttcctgttcaacaacggttatgccgaccaggttacc
aacgtactgaaagcacacggtatcgaaaccgaagtcttcttcgaagttgaagccgatccg
accctgagcatcgtgcgcaaaggcgccgaacagatgaactccttcaagccggacgtgatc
atcgcgctgggcggcggctccccgatggatgcggccaaaatcatgtgggtgatgtacgag
catccggaaacccacttcgaagagctggcgctgcgctttatggatatccgtaagcgtatc
tacaagttcccgaaaatgggcgtcaaagccaagatgatcgccatcaccaccacctctggc
accggctctgaagtaacgccgttcgccgtggtgaccgacgacgcgaccgggcagaaatac
ccgctggctgactatgcgctgacgccggacatggccatcgttgatgccaacctggtgatg
aatatgccgaaatccctgtgcgccttcggcggtctggatgcggtaacccatgcgctggaa
gcctacgtttccgttttggccaacgaatactctgacggccaggcactgcaggctctgaaa
ctgctgaaagagttcctgccggccagctatgccgaaggcgctaaaaacccggtagcccgc
gagcgtgtgcacaacgccgccactatcgccggcatcgcgtttgccaacgccttcctcggg
gtatgtcactccatggcccacaaactgggctccgagttccacattccgcacggtctggcc
aacgccctgctgatctcgaacgttattcgctacaacgcgaacgacaacccgaccaagcag
accgcgttcagccagtacgaccgtccgcaggcgcgtcgtcgttacgctgaaatcgcagac
cacctgggtctgagcgcaccgggcgaccgcaccgcgcagaagatcgagaagctgctggcc
tggctggagagcatcaaggctgaactgggtatcccggcctccatccgtgaagccggcgta
caggaagccgacttcctggcgaaagtggacaagctgtccgaagatgctttcgacgatcag
tgcaccggcgccaacccgcgctatccgctgattgccgaactcaagcaaattctgctggac
acctactatggccgcgagttcgtcgagcacgcgcaggaagaaagcaagaccgttgccgcg
ccgaaagcggaaaagaaggccaaaaaagcctga

DBGET integrated database retrieval system