KEGG   Edwardsiella tarda FL6-60: ETAF_1421Help
Entry
ETAF_1421         CDS       T02091                                 

Definition
Indole-3-glycerol phosphate synthase / Phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:etd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:etd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1632432..1633808)
Genome map
AA seq 458 aa AA seqDB search
MTQPSPSPASLLSRIIADKRRWIAARERQQPLSDFQSTLRRSERDFHRALNATPRALILE
CKKASPSRGLIRADFDPQAIARVYRDHAAAISVLTDGDYFQGDFRYLRAVSDVVTQPVLC
KDFILSPYQIYLARHYRADAILLMLSVLDDAQYRQLAAVATALNMGILTEVSTPAEMARA
VALGARAIGINNRNLHDLSVDPERTRHLAALAPPGATLIAESGIHSHAQIRDLGRLVQGF
LIGSALMSQPDLRSAVCRLRFGDNKVCGLTRPEDAVSALCSGAVYGGLIFVADSPRYVDI
ATARGIISAAPLRYVGVFRDAKPASVALAAERLDLHAVQLHGGEDQAYIDSLRPLLPAAC
RIWKALPVSDTLPTARLHHVDRYLLDGVRPGSGHPFDWRLLDGHPLGDIMLAGGIGADNC
RAAADLGALGLDFNSAVESAPGRKDPRKLRAAFQALLA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccctcgccatcgcccgccagcctgctcagccgcatcatcgccgataaacgg
cgctggatcgccgcccgggaacggcagcagccgctgtcagactttcaatctaccctgcgg
cgcagcgaacgcgactttcaccgggcgctcaacgcgacgccgcgcgccctgatcctggag
tgtaaaaaagcatcgccttcgcgcgggctaatccgagctgactttgacccgcaggctatc
gcacgggtataccgcgatcatgccgccgccatctcggtcctaaccgacggcgactatttt
cagggtgacttccgctatctgcgcgcggtaagtgacgttgtcacgcagccggtgctgtgt
aaagacttcatcctctcgccttaccagatctatctggcgcgccattaccgcgccgatgcc
atcctgctgatgctctccgtattggacgatgcacagtaccgccagctggccgccgtggcc
acggcgctgaacatggggatcctcaccgaggtcagcacccccgccgaaatggcgcgcgcc
gtcgcgctgggcgccagggcgatcggtattaataaccgtaatctgcacgatctcagcgtc
gatcccgagcgtacccggcatctcgcggcgttggcgccgccgggcgcgacgcttatcgcc
gagtccggtatccacagccacgcccaaatccgcgacctgggtcgcctggtgcagggcttt
ttgatcggcagcgcgctgatgtctcagcccgatctgcgcagcgccgtctgtcgtctgcgc
tttggcgacaataaggtctgcggcctgacacgccctgaagacgcggtcagcgcgctgtgc
tccggcgccgtctacggtggcctgatcttcgttgccgactcgccgcgctacgtcgatatc
gccaccgcccgcggcattatttcggccgccccgctgcggtacgtcggggtctttcgcgac
gccaagcccgccagcgttgcgctggccgcagagcgcctggatctgcacgccgttcaactg
cacggcggcgaagatcaggcctatatcgatagcctgcgtccgctgttaccggcggcctgt
cggatttggaaggcgctgccggtcagcgataccctgcctaccgcgcgcctgcaccacgtc
gatcgctacctgcttgacggcgtacgccccggcagcggacacccctttgactggcgcctg
ctggatggacatcccctgggcgacatcatgctggccggggggatcggcgccgataactgc
cgcgcagcggccgacctcggcgcgctgggcctcgattttaactccgccgtggagtccgct
cccgggcgtaaagatcccaggaaactccgtgcggccttccaggcgctgctcgcctga

DBGET integrated database retrieval system