KEGG   Edwardsiella tarda FL6-60: ETAF_1551Help
Entry
ETAF_1551         CDS       T02091                                 

Definition
Cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
etd  Edwardsiella tarda FL6-60
Brite
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ETAF_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1774957..1776420)
Genome map
AA seq 487 aa AA seqDB search
MKKITKWAGGIVIAGLACYLGLVGYVYNHDKQRNTVPSEPASSPLNAQVLGILSEKGCDY
CHTPSANLPFYASVPGVKQLMEYDMYQGYKAFNLTPLRESLLKPSPWKTASGQPPTLTDL
NKLEWVVQHQTMPPTRYTAMHWAGRMSQADRDTLLTWVDEQRQKYYATPDMAPSLRNEPI
QPIPESLPVNAEKVALGFRLYHDPRLSSNDTVACAHCHQLGAGGVDGRKTSLGVDDQVGP
INAPTVFNSAFNIAQFWDGRAATLQDQAGGPPLNPIEMASTSWEQIIDKLNQDQAFKQAF
LKVYPQGFSGKTITDAIAEFERTLITPNSAFDRYLRGDSSALTAQQQRGYQLFKDNRCAT
CHAGVAMGGESYEPLGLIKAYPFGEMTSADIGRMNVTQDLRDKLRQKVPTLRNVELTGPY
FHRGDVQTLDEAVKQMLRYQVGVTLPQSDVDDIVAFLKSLNGVYTPYPMNTAAAEAPATP
TTETAHP
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataacgaaatgggcgggaggcatcgtcattgccggtctcgcctgctactta
gggttggtcggctatgtctataatcatgacaaacagcgtaataccgtaccgagtgaaccg
gcaagttcaccgcttaatgcgcaggtattggggatactgagcgaaaaaggctgtgactac
tgccatacaccatcggctaatttgccgttttacgccagcgttcccggcgtgaaacagctg
atggagtatgacatgtatcagggatataaggcgttcaacctgactcccctgcgcgaaagt
ctgctgaaaccctccccgtggaaaaccgccagcggccaaccgccgaccctgacggatctc
aataagctggaatgggtggttcagcatcaaaccatgccgccaacccgctataccgcaatg
cactgggccggtcggatgtcgcaggccgatcgcgatacgctgctgacgtgggtggatgag
cagcgtcaaaaatactatgcaacgccggatatggcgccctcgctgcgcaatgagccgata
cagccgatccctgagtctttaccggtcaacgccgaaaaagtcgcgctgggattccgtctg
taccacgatccgcgcttatccagcaatgacaccgtggcctgcgcccactgtcaccagctg
ggcgccggtggcgtcgatgggcggaaaacatcgctcggcgtcgatgaccaggttggcccc
atcaacgcgccaacggtgtttaactctgcgttcaacatcgcccagttctgggatggccgt
gcggcaaccctgcaggatcaggccggtgggccaccgctgaatccgatcgagatggcgtcc
acatcgtgggagcagatcatcgataagctgaatcaagatcaggcatttaagcaggcgttc
ctcaaggtatatccgcagggcttcagtggaaaaaccatcactgacgccatcgccgagttt
gagaggaccctgattacgccgaactccgcgtttgaccgctacctgcgcggcgatagcagc
gcgctcacggcccagcagcagcgtggctatcagctatttaaggataaccgctgcgcaacc
tgccacgccggcgtggccatggggggagagtcttacgagccactcgggctgatcaaggca
tatccgtttggcgaaatgaccagcgcggacatcggtcggatgaacgtcacccaggatctg
cgcgataagctgcgccagaaggtaccgacgctgcgtaacgttgagctgaccgggccctac
ttccaccgtggcgatgtgcagacgctggatgaggccgtgaagcagatgctgcgctatcag
gtcggcgtcaccctgccgcaaagcgatgtcgacgatatcgtggccttcctgaagagcctg
aacggtgtctatacgccgtacccgatgaacacggccgccgcagaagctccggcgacgcca
acgacggagacggcccatccgtag

DBGET integrated database retrieval system