KEGG   Edwardsiella tarda FL6-60: ETAF_1585Help
Entry
ETAF_1585         CDS       T02091                                 

Gene name
folM
Definition
(GenBank) Alternative dihydrofolate reductase 1 FolM
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00670  One carbon pool by folate
etd00790  Folate biosynthesis
etd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETAF_1585 (folM)
   00670 One carbon pool by folate
    ETAF_1585 (folM)
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ETAF_1585 (folM)
    1.5.1.50  dihydromonapterin reductase
     ETAF_1585 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR CcdB Wax2_C
Motif
Other DBs
NCBI-ProteinID: ADM41693
UniProt: A0A0H3DTE8
Position
1813797..1814519
Genome map
AA seq 240 aa AA seqDB search
MDTLSMPPVVITGGARRVGLALALSLLAREIPVLVAYRSEYPALASLRQAGAHCLQSDFS
TTEGIYDFAARVQRITPRLRALIHNASAWQAERPDVAPEQTLNAMLQIHVHTPYLLNLLL
EPLLRGQGDAGADIIHLTDYVVERGSDSHIAYAAGKAALDNMTRSFARKLAPEVKVNAIA
PALILFNPQDDEAYRQKALDKSLMKIAAGEQEIVNAIDFLLNSRFITGRTIGVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggatacgctgtccatgccgccggtggtgatcaccggcggcgcccgccgcgtcggactg
gcgctggccctctccctgcttgccagagagatccccgtactggtggcctaccgcagtgaa
taccctgccctggcctcgctgcgtcaggccggggcgcactgcctacagagtgacttctcg
acgacggaggggatctatgacttcgccgcgcgggtgcagcgcatcacgccccgcctgcgg
gcgctgatacacaacgccagcgcctggcaggccgaacgccccgacgtagcgccggagcag
acgctcaatgccatgctgcagatccatgtccacacgccctacctgctgaatctgctgcta
gagccgctgctgcgtgggcagggagacgccggcgccgatatcatccatttgaccgattat
gtcgtggagcgcggcagcgatagccatatcgcctatgccgccggcaaggccgcgctggac
aatatgacgcgctcctttgcccgcaagctggcgccagaggtcaaggtcaacgccatcgcc
ccggcgctgatcctgttcaatccgcaggatgatgaggcctatcggcaaaaagcgctggat
aagtcgctgatgaaaattgccgcaggcgaacaagagattgtcaatgccattgacttcctg
ttgaatagtcgtttcattaccggtcgtaccataggggtcgacggtggccgtcccctgcgc
taa

DBGET integrated database retrieval system