KEGG   Edwardsiella tarda FL6-60: ETAF_1647Help
Entry
ETAF_1647         CDS       T02091                                 

Definition
(GenBank) 6-phosphofructokinase class II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00010  Glycolysis / Gluconeogenesis
etd00030  Pentose phosphate pathway
etd00051  Fructose and mannose metabolism
etd00052  Galactose metabolism
etd00680  Methane metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01130  Biosynthesis of antibiotics
etd01200  Carbon metabolism
etd01230  Biosynthesis of amino acids
Module
etd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_1647
   00030 Pentose phosphate pathway
    ETAF_1647
   00051 Fructose and mannose metabolism
    ETAF_1647
   00052 Galactose metabolism
    ETAF_1647
  Energy metabolism
   00680 Methane metabolism
    ETAF_1647
Enzymes [BR:etd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ETAF_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617 Sulf_coat_C
Motif
Other DBs
NCBI-ProteinID: ADM41755
UniProt: A0A0H3DQV0
Position
complement(1885025..1885978)
Genome map
AA seq 317 aa AA seqDB search
MNPIYTLTLSPSLDCSTSTAKIYPEGKLRCSQAIYQPGGGGINVARAIQRMGGGAVAIYP
AGGSTGAHLTTLLLAEGVAVDTIEAQAWTRQNMHVSATATGEQFRFVMPGAALTPREFDL
LAQRLDQIPTDALLVVSGSLPENITPSRFSALLQHIRQRGIRCVVDTSGDALMAAVNQGG
LTLIKPNQKELATLSGRDMTQPASVLQAAHALVLQGAAQYVVVSLGAQGAIAVDRQAWIQ
VTPPPIKALTTVGAGDSMVAAMTLQLAQGGALSALAIGGVAAGTAATLRHGTELCQASDV
AEIVAYIEAHHPQPHSF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctatctatacccttacgctgtctccctcgctggactgttcgaccagcacggcc
aaaatatatcctgagggtaagctacgctgcagtcaggccatctaccaaccgggcggcggt
gggatcaacgtggcccgggccattcagcgcatgggcggcggcgccgtggccatctatccg
gcgggaggatcgaccggcgcgcacttgaccacgctgctgctggcggagggggtggcggtc
gatacgatcgaggcgcaggcctggacgcgtcagaatatgcatgtcagtgcgacggcgacc
ggcgagcagttccgttttgtgatgcccggcgcggcgctgacgccgcgggagttcgatctc
ctggcgcaacgattggatcagatcccgaccgatgccctcttggtggtgagtgggagtctg
ccggagaacattacgccgtcgcggttttccgcgctgctgcagcacattcgtcagcgcggt
attcgctgcgtcgtcgatacctcgggcgatgccctgatggcggcggtgaatcaaggggga
ctgacgctgattaagcccaatcaaaaggagctggcgacgttgagcggtcgagatatgacc
cagccggcctcggttttgcaggcggcccacgcgctggtattacagggcgccgcacagtat
gtggtggtttcgctgggggcgcagggggcgattgccgtcgatcgccaggcctggattcag
gtgacgccgccgccgattaaggcactgacgacggtgggggccggcgacagtatggtcgcc
gcgatgacgctgcagctggctcagggaggagcgctgagcgcgctggcgatcggcggcgtt
gcggccggaaccgcggcgacgctgcgccatggcaccgaactctgccaggcgagcgatgtc
gccgagatcgtggcttatatcgaggcccaccacccacagccgcattcattttaa

DBGET integrated database retrieval system