KEGG   Edwardsiella tarda FL6-60: ETAF_1701Help
Entry
ETAF_1701         CDS       T02091                                 

Definition
Beta N-acetyl-glucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAF_1701
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ETAF_1701
Enzymes [BR:etd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ETAF_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1947620..1948642)
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVAGYALDAEEREILDHPLVGGVILFSRNFDDPGQLRELVRQIRQAARHPLLVT
VDQEGGRVQRFHQGFTRLPAAQSYAALNAPQEAQRLALEGGWLMACEMIAMDIDLSFAPV
LDLGHGSAAIGERAFHREAESAIPLAQAFIDGMHQAGMKATGKHFPGHGKVSADSHKETP
IDERPLAQIVEHDMVIFKTLNARARLDAVMPAHVIYSQADSRPASGSPYWLQQVLRQALG
FDGVIFSDDLSMNGAAVMGSYAQRAQASLDAGCDMVLVCNNRQGAISVLDHLSAAGSPRI
ERLRHRGQVDREGLMGSARWKQAHQDLQRLHQRWEEAKQA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggccctgtaatgctggatgtcgccggctatgcgctggatgccgaggagcgagagatc
ctggaccatccgttggtcggtggcgtgatcctgtttagccgtaattttgacgatccgggc
cagctgcgcgagctggtgcgccaaattcgccaggcggcgcgccaccctttactggtgacc
gtcgatcaggaggggggacgggtgcagcgcttccatcaggggtttacccgcctgccggca
gcgcagtcctatgccgcgctcaatgcgccgcaggaggcgcagcgcctggcgctggagggc
ggctggctgatggcctgcgagatgatcgcgatggatatcgatctgagctttgcgccggtg
ctggatttggggcacggcagcgccgccatcggcgagcgggcgttccatcgggaggcggag
agcgccattccgctggcgcaggcgtttatcgacgggatgcaccaggcgggaatgaaggcg
accggcaagcattttccggggcacggcaaggtgagcgcggactcccataaggagacgccg
atcgacgagcgcccgctggcgcaaatcgttgagcatgatatggttattttcaagacgctg
aatgcgcgcgccaggctggatgcggtcatgccggcccacgtgatctactcacaggcggac
tcccgtccggccagcggctcaccctactggctgcagcaggtgctgcgtcaggcgctgggc
ttcgatggggtgatcttctcggatgacctgtcgatgaacggggcggcggtgatgggcagc
tacgcgcagcgggcgcaggcgtctctggacgccggctgcgatatggtgctggtctgcaat
aaccgccagggcgcgatcagcgtgctggaccacctgtccgccgcggggtcgccgcgcatc
gagcgtctgcgtcaccgtggtcaggtcgatcgcgaggggctgatgggcagcgcgcgctgg
aagcaggcgcatcaggatttgcaacgcttacaccagcgctgggaggaggccaaacaggcc
tga

DBGET integrated database retrieval system