KEGG   Edwardsiella tarda FL6-60: ETAF_1728Help
Entry
ETAF_1728         CDS       T02091                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ETAF_1728
  Lipid metabolism
   00561 Glycerolipid metabolism
    ETAF_1728
   00600 Sphingolipid metabolism
    ETAF_1728
Enzymes [BR:etd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ETAF_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1972759..1974111)
Genome map
AA seq 450 aa AA seqDB search
MNAPKIAFIGAGSTIFVKNILGDVFQRPALRGADIALMDIDAQRLAESQIVVGRLMAATG
ATGRIQCHTTLRPALQGADFVVVAFQIGGYTPCTVTDFEVCARHGLRQTIGDTLGPAGIM
RALRTFPHLWQLGEMMMAECPQATLLNYVNPMAMNSWAMYARYPQLRQVGLCHSVQGTAE
ELARDLDIDPAQLRYRCAGINHMAFYLSLEQRGEDGQYRDLYPQLQQAYREGRAPKPNIH
GNLRCENIVRYALLQKLGYFVTESSEHMAEYTPWFIKPGRDDLIARYRIPLDEYPKRCVE
QMANWQRELAAYQTAQPIAITPSQEYASRIMNALWSGEPEVIYGNVRNAGLIDNLPQGCC
VEVPCLVDANGIQPTRIGALPSHLAALMQTNINVQTLVTEAALTENRERIYHAALLDPHT
AAALSIDEIYALIDDLIAAHGEWLPAWVRG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctaaaattgcctttattggcgccggttcaaccatttttgtgaagaatatt
ctcggggatgtcttccagcgccccgcgctgcgaggggcggatatcgcgctgatggatatc
gatgcgcagcgtctggccgagtcgcagatcgtcgtggggcggctgatggcagcgaccggg
gccactggacgcattcagtgccatacgacgctgcgtccggcgctgcagggggccgatttt
gtggtggtggcgtttcagatcggtggctatacgccctgcacggtcaccgattttgaggtc
tgcgcgcgccatggcctgcgccagaccatcggcgataccctgggcccggccggcattatg
cgcgcgctgcgtacctttccacacctgtggcagctaggcgagatgatgatggcggagtgc
ccgcaggcgacgctgctgaactatgtcaacccgatggcgatgaatagctgggccatgtat
gcgcgttatccgcagctgcggcaggtcggtctctgccactcggtacagggcacggcggag
gagctggcgcgggatctcgatatcgatccggcgcagctgcgctaccgctgcgccgggatt
aaccatatggccttctatctttcgctggagcagcgcggcgaagacggtcagtatcgcgat
ctctacccgcagctgcagcaggcctaccgagaggggcgggcgccgaagccgaacatccac
ggcaacctgcgctgcgagaatatcgtgcgctatgcgctgctgcagaagctgggttacttt
gtcacggagtcctcggagcatatggccgaatatacgccgtggtttatcaagcccggacgc
gacgatctgatcgcgcgttatcgcattccgctggatgagtatcccaagcgctgcgtagag
cagatggcgaactggcagcgcgagctggcggcgtatcagacggcgcagcctatcgcgatt
acgccgtcgcaggagtatgccagccggatcatgaatgcgctgtggagcggggagccggag
gtgatctatggtaatgtgcgtaacgcggggctgatcgataatctgccgcagggctgctgc
gtggaggtgccgtgtctggtcgacgccaacgggatccagccgacccggatcggggcgctg
ccctcgcacctggcggcgctgatgcagaccaatatcaatgtgcaaacgttggtgacggag
gcggcgctgacggaaaaccgcgagcggatataccatgccgcgctgctcgatccgcatacg
gccgcggcgctgagcatcgatgagatctatgccctgatcgacgatctcatcgcggcgcac
ggcgagtggctgcccgcgtgggtgcgtggctga

DBGET integrated database retrieval system