KEGG   Edwardsiella tarda FL6-60: ETAF_1823Help
Entry
ETAF_1823         CDS       T02091                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00071  Fatty acid degradation
etd00072  Synthesis and degradation of ketone bodies
etd00280  Valine, leucine and isoleucine degradation
etd00310  Lysine degradation
etd00380  Tryptophan metabolism
etd00620  Pyruvate metabolism
etd00630  Glyoxylate and dicarboxylate metabolism
etd00640  Propanoate metabolism
etd00650  Butanoate metabolism
etd00900  Terpenoid backbone biosynthesis
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01130  Biosynthesis of antibiotics
etd01200  Carbon metabolism
etd01212  Fatty acid metabolism
etd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAF_1823
   00630 Glyoxylate and dicarboxylate metabolism
    ETAF_1823
   00640 Propanoate metabolism
    ETAF_1823
   00650 Butanoate metabolism
    ETAF_1823
  Lipid metabolism
   00071 Fatty acid degradation
    ETAF_1823
   00072 Synthesis and degradation of ketone bodies
    ETAF_1823
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ETAF_1823
   00310 Lysine degradation
    ETAF_1823
   00380 Tryptophan metabolism
    ETAF_1823
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETAF_1823
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ETAF_1823
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ETAF_1823
Enzymes [BR:etd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ETAF_1823
Exosome [BR:etd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAF_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADM41931
UniProt: A0A0H3DRF0
Position
2074779..2075963
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGALSGVSAIDLGATVIRAALERARLDPQRVDEVIMGNVLQAG
LGQNPARQALLRAGLSEAVCGFTVNKVCGSGLKSVALAAQAIQAGQAQALVAGGMENMSQ
APYLLNAKARWGYRLGDGTLTDVILQDGLLCATHGYPMGITAENIAREYGISREMQDALA
LHSQQKAASALQRGAFRAEIVPVSVTSRKKTTLVERDEFPKADTTAEGLAALRPAFDQAG
SVTAGNASGINDGAAALVVMEESAARAAGLTPLARIKGYASAGVAPALMGMGPVPAAQKA
LRQCGLQMTDIDLIEANEAFAAQFLAVGRTLGLEAEKVNVNGGAIALGHPIGASGARILV
TLLHALAARDKTLGLATLCIGGGQGIALIVERIG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggtacgcaccgccatcggcagcttcaacggcgcc
ctgtccggcgtcagcgccatcgatctgggcgccacggtcatcagggccgccctggaacgc
gcccgcctcgacccgcagcgggtggatgaggtgatcatgggcaacgtgctgcaggccggc
ctggggcaaaacccggcgcgccaggcgctgctgcgggccggcctcagcgaggcggtctgc
ggttttaccgtcaacaaggtctgcggatcggggcttaagagcgtggcgctggccgcccag
gccattcaggcggggcaggcgcaggcgctggtcgccggcggtatggaaaacatgagtcag
gcgccgtacctgctgaatgcaaaggcgcgctggggctaccgcctgggcgacggcacgctg
accgacgttatcctgcaggatggcctgctgtgcgccacccacggctacccgatggggatc
accgccgaaaacatcgcccgcgaatacggcatcagccgtgagatgcaggatgcgctggcc
ctgcactcccagcaaaaggcggccagcgccctccagcgcggcgcgtttcgggccgagatc
gtcccggtcagcgtgacatcgcggaaaaaaaccaccctcgttgagcgcgacgaattcccc
aaagccgacaccacggcggaagggctcgccgccctgcgcccggcgttcgatcaggccggc
agcgtcaccgccggcaacgcctcggggatcaacgacggcgcggcggcgctggtggtgatg
gaggaaagcgccgcccgggcggcggggctgacgccgctggcgcggattaagggctatgcc
agcgccggcgtcgcaccggcgctgatggggatggggccggtgcccgccgcccagaaggcg
ctgcgccagtgcgggctgcagatgaccgatatcgatctgattgaggccaacgaagccttt
gccgcgcagttcctggccgtcggcaggacgctggggctggaggctgaaaaggtcaacgtc
aacggcggcgccatcgcgctgggccaccccatcggcgccagcggcgcccggatcctggtc
accctgctgcacgcgctcgccgcccgggacaaaaccctggggctggcgacgctgtgcatc
ggcggcggccaggggatcgccctgatcgtggagaggatcggctaa

DBGET integrated database retrieval system