KEGG   Edwardsiella tarda FL6-60: ETAF_1915Help
Entry
ETAF_1915         CDS       T02091                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAF_1915
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ETAF_1915
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ETAF_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2185269..2186039
Genome map
AA seq 256 aa AA seqDB search
MINLQGKVALITGSTSGIGLGIAKTLAQQGAQVILNGFGDVAHATGQIAACGLPPGYHSA
DLSHPDHIAAMMDYATTQFGGVDILVNNAGIQHVASVEHFPEEQWDAILAVNLSSVFHTS
RLALPALREKGWGRIINIASVHGLVASTQKAAYVAAKHGVVGLTKVIALETARSPVTCNA
ICPGWVLTPLVQQQIAARAADGDTQQARDALLAEKQPSLDFVTPQQLGALALFLCSPAAD
QVRGAAWNVDGGWLAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgataaacctacaaggcaaagtcgcattgataaccggctcaaccagtggaatcgggttg
ggtattgcgaaaacgctggcgcagcagggcgcgcaggtcattctgaatggctttggcgac
gttgcgcacgccaccgggcaaatagccgcgtgcggcctccccccgggctaccactcggct
gacctgagccatcccgaccatatcgccgccatgatggattacgccactacacagttcggc
ggcgtggacattctggtcaataacgcgggaatacagcatgtcgccagcgtagagcatttc
ccggaggagcaatgggatgcaatcctcgcagtcaacctctcttctgtatttcataccagc
cgtctggccttgcctgccctacgggagaagggctggggccgcataatcaatatcgcctcc
gtgcacggcttggtcgcctccacgcaaaaggcggcatacgtggcggccaagcatggcgtg
gtggggctgacgaaggtgattgcgctggaaaccgcgcgcagcccggtcacctgtaatgcc
atctgccccggttgggtactcacgcccctggtgcaacagcagatagcggcgcgggctgcc
gacggtgatacccagcaggctcgggatgcgctactggcagagaagcagccgtcgctggat
tttgtgacgccgcagcaattaggcgcgctggcgctatttttatgcagcccggcggccgat
caggtgcgcggtgcggcgtggaatgtggacgggggctggctggctcaatag

DBGET integrated database retrieval system