KEGG   Edwardsiella tarda FL6-60: ETAF_2310Help
Entry
ETAF_2310         CDS       T02091                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAF_2310
   01230 Biosynthesis of amino acids
    ETAF_2310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_2310
  Energy metabolism
   00680 Methane metabolism
    ETAF_2310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAF_2310
Enzymes [BR:etd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ETAF_2310
Exosome [BR:etd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ETAF_2310
  Exosomal proteins of melanoma cells
   ETAF_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2626049..2626801
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNRENRFTGWTDVELSEKGRQEARAAGRLLKAQGFSFDVAYTSVL
KRAIHTLWHVLDEIDQPWLAVEKSWKLNERHYGALQGLNKAETAQQYGDEQVKLWRRAFA
ITPPALTPDDPRYPGHDPRYAALSADELPLTESLATTIERVIPYWQQQIAPRIAAGERII
IAAHGNSLRALVKHLDHLSESEIIELNIPTGVPLVYEFDADMQPLRHYYLGDADEIAARQ
NAVANQGKAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaccaaactggttctggtccgtcacggcgaaagcgagtggaaccgggaaaac
cgcttcaccggctggaccgacgttgaactgtcagagaaagggcgccaagaggcgcgggcg
gcgggtcgccttctgaaggcgcagggattttcctttgacgtcgcctacacctccgtgctc
aagcgcgccattcacaccctgtggcacgtactggatgagatcgatcagccgtggcttgcg
gttgaaaaatcatggaagctcaatgagcgccactacggcgccctgcaggggctgaacaag
gcggagaccgcgcagcagtacggcgacgaacaggtcaagctgtggcgccgcgcctttgcc
atcaccccaccggctctgacgccggacgatccccgctatcccggccacgatccgcgctat
gcggccctaagcgccgacgagctcccgctgacggagagcctggccaccaccattgagcgg
gtgatcccctattggcagcagcagatcgcgccgcgcatcgccgccggcgagcggatcatc
atcgccgcccacggcaattcgctgcgcgcgctggtcaagcatctggatcatctgagcgaa
agtgagattatcgagctgaatatcccgaccggggttccgctggtgtatgagtttgacgcc
gatatgcagccgctgcgccactactaccttggcgacgccgacgagattgccgcccgccaa
aacgccgtcgccaatcagggcaaggcgggctaa

DBGET integrated database retrieval system