KEGG   Edwardsiella tarda FL6-60: ETAF_2310Help
Entry
ETAF_2310         CDS       T02091                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAF_2310
   01230 Biosynthesis of amino acids
    ETAF_2310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_2310
  Energy metabolism
   00680 Methane metabolism
    ETAF_2310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAF_2310
Enzymes [BR:etd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ETAF_2310
Exosome [BR:etd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ETAF_2310
  Exosomal proteins of melanoma cells
   ETAF_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2626049..2626801
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNRENRFTGWTDVELSEKGRQEARAAGRLLKAQGFSFDVAYTSVL
KRAIHTLWHVLDEIDQPWLAVEKSWKLNERHYGALQGLNKAETAQQYGDEQVKLWRRAFA
ITPPALTPDDPRYPGHDPRYAALSADELPLTESLATTIERVIPYWQQQIAPRIAAGERII
IAAHGNSLRALVKHLDHLSESEIIELNIPTGVPLVYEFDADMQPLRHYYLGDADEIAARQ
NAVANQGKAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaccaaactggttctggtccgtcacggcgaaagcgagtggaaccgggaaaac
cgcttcaccggctggaccgacgttgaactgtcagagaaagggcgccaagaggcgcgggcg
gcgggtcgccttctgaaggcgcagggattttcctttgacgtcgcctacacctccgtgctc
aagcgcgccattcacaccctgtggcacgtactggatgagatcgatcagccgtggcttgcg
gttgaaaaatcatggaagctcaatgagcgccactacggcgccctgcaggggctgaacaag
gcggagaccgcgcagcagtacggcgacgaacaggtcaagctgtggcgccgcgcctttgcc
atcaccccaccggctctgacgccggacgatccccgctatcccggccacgatccgcgctat
gcggccctaagcgccgacgagctcccgctgacggagagcctggccaccaccattgagcgg
gtgatcccctattggcagcagcagatcgcgccgcgcatcgccgccggcgagcggatcatc
atcgccgcccacggcaattcgctgcgcgcgctggtcaagcatctggatcatctgagcgaa
agtgagattatcgagctgaatatcccgaccggggttccgctggtgtatgagtttgacgcc
gatatgcagccgctgcgccactactaccttggcgacgccgacgagattgccgcccgccaa
aacgccgtcgccaatcagggcaaggcgggctaa

DBGET integrated database retrieval system